Homo sapiens (human): 91860 Help Entry 91860             CDS       T01001                                  Symbol CALML4, NY-BR-20 Name (RefSeq) calmodulin like 4   KO K02183   calmodulin Organism hsa  Homo sapiens (human) Pathway hsa04014   Ras signaling pathway hsa04015   Rap1 signaling pathway hsa04020   Calcium signaling pathway hsa04022   cGMP-PKG signaling pathway hsa04024   cAMP signaling pathway hsa04070   Phosphatidylinositol signaling system hsa04114   Oocyte meiosis hsa04218   Cellular senescence hsa04261   Adrenergic signaling in cardiomyocytes hsa04270   Vascular smooth muscle contraction hsa04371   Apelin signaling pathway hsa04625   C-type lectin receptor signaling pathway hsa04713   Circadian entrainment hsa04720   Long-term potentiation hsa04722   Neurotrophin signaling pathway hsa04728   Dopaminergic synapse hsa04740   Olfactory transduction hsa04744   Phototransduction hsa04750   Inflammatory mediator regulation of TRP channels hsa04910   Insulin signaling pathway hsa04912   GnRH signaling pathway hsa04915   Estrogen signaling pathway hsa04916   Melanogenesis hsa04921   Oxytocin signaling pathway hsa04922   Glucagon signaling pathway hsa04924   Renin secretion hsa04925   Aldosterone synthesis and secretion hsa04970   Salivary secretion hsa04971   Gastric acid secretion hsa05010   Alzheimer disease hsa05012   Parkinson disease hsa05022   Pathways of neurodegeneration - multiple diseases hsa05031   Amphetamine addiction hsa05034   Alcoholism hsa05133   Pertussis hsa05152   Tuberculosis hsa05163   Human cytomegalovirus infection hsa05167   Kaposi sarcoma-associated herpesvirus infection hsa05170   Human immunodeficiency virus 1 infection hsa05200   Pathways in cancer hsa05214   Glioma hsa05417   Lipid and atherosclerosis hsa05418   Fluid shear stress and atherosclerosis Drug target Lubeluzole:  D04789 Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     91860 (CALML4)    04015 Rap1 signaling pathway     91860 (CALML4)    04371 Apelin signaling pathway     91860 (CALML4)    04020 Calcium signaling pathway     91860 (CALML4)    04070 Phosphatidylinositol signaling system     91860 (CALML4)    04024 cAMP signaling pathway     91860 (CALML4)    04022 cGMP-PKG signaling pathway     91860 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     91860 (CALML4)    04218 Cellular senescence     91860 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     91860 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     91860 (CALML4)    04922 Glucagon signaling pathway     91860 (CALML4)    04912 GnRH signaling pathway     91860 (CALML4)    04915 Estrogen signaling pathway     91860 (CALML4)    04921 Oxytocin signaling pathway     91860 (CALML4)    04916 Melanogenesis     91860 (CALML4)    04924 Renin secretion     91860 (CALML4)    04925 Aldosterone synthesis and secretion     91860 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     91860 (CALML4)    04270 Vascular smooth muscle contraction     91860 (CALML4)   09154 Digestive system    04970 Salivary secretion     91860 (CALML4)    04971 Gastric acid secretion     91860 (CALML4)   09156 Nervous system    04728 Dopaminergic synapse     91860 (CALML4)    04720 Long-term potentiation     91860 (CALML4)    04722 Neurotrophin signaling pathway     91860 (CALML4)   09157 Sensory system    04744 Phototransduction     91860 (CALML4)    04740 Olfactory transduction     91860 (CALML4)    04750 Inflammatory mediator regulation of TRP channels     91860 (CALML4)   09159 Environmental adaptation    04713 Circadian entrainment     91860 (CALML4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     91860 (CALML4)   09162 Cancer: specific types    05214 Glioma     91860 (CALML4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     91860 (CALML4)    05163 Human cytomegalovirus infection     91860 (CALML4)    05167 Kaposi sarcoma-associated herpesvirus infection     91860 (CALML4)   09171 Infectious disease: bacterial    05133 Pertussis     91860 (CALML4)    05152 Tuberculosis     91860 (CALML4)   09164 Neurodegenerative disease    05010 Alzheimer disease     91860 (CALML4)    05012 Parkinson disease     91860 (CALML4)    05022 Pathways of neurodegeneration - multiple diseases     91860 (CALML4)   09165 Substance dependence    05031 Amphetamine addiction     91860 (CALML4)    05034 Alcoholism     91860 (CALML4)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     91860 (CALML4)    05418 Fluid shear stress and atherosclerosis     91860 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hsa01009]     91860 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsa04131]     91860 (CALML4)    03036 Chromosome and associated proteins [BR:hsa03036]     91860 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsa04147]     91860 (CALML4) Protein phosphatases and associated proteins [BR:hsa01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      91860 (CALML4) Membrane trafficking [BR:hsa04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     91860 (CALML4) Chromosome and associated proteins [BR:hsa03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      91860 (CALML4) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    91860 (CALML4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_1 EF-hand_9 AIF-1 EH EF-hand_11 GPHH Motif Other DBs NCBI-GeneID:  91860 NCBI-ProteinID:  NP_219501 OMIM:  620520 HGNC:  18445 Ensembl:  ENSG00000129007 UniProt:  Q96GE6 A0A804DNR1 LinkDB All DBs Position 15:complement(68190705..68206110) Genome browser AA seq 153 aa AA seqDB search MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDG NGELDFSTFLTIMHMQIKQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHK EVDDLFREADIEPNGKVKYDEFIHKITLPGRDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagtttctttcccaagaccaaattaatgagtacaaggaatgcttctccctgtat gacaagcagcagagggggaagataaaagccaccgacctcatggtggccatgaggtgcctg ggggccagcccgacgccaggggaggtgcagcggcacctgcagacccacgggatagacgga aatggagagctggatttctccacttttctgaccattatgcacatgcaaataaaacaagaa gacccaaagaaagaaattcttctagccatgttgatggtggacaaggagaagaaaggttac gtcatggcgtccgacctgcggtcaaaactcacgagtctgggggagaagctcacccacaag gaagtggatgatctcttcagggaagcagatatcgaacccaatggcaaagtgaagtatgat gaatttatccacaagatcacccttcctggacgggactattga

DBGET integrated database retrieval system