KEGG   Homo sapiens (human): 9322
Entry
9322              CDS       T01001                                 
Symbol
TRIP10, CIP4, HSTP, STOT, STP, TRIP-10
Name
(RefSeq) thyroid hormone receptor interactor 10
  KO
K07196  thyroid hormone receptor interactor 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    9322 (TRIP10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9322 (TRIP10)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    9322 (TRIP10)
SSDB
Motif
Pfam: FCH SH3_1 SH3_9 SH3_3 SH3_2 Lzipper-MIP1 DUF481 SH3_4 DUF2202 zf-C4H2
Other DBs
NCBI-GeneID: 9322
NCBI-ProteinID: NP_001275891
OMIM: 604504
HGNC: 12304
Ensembl: ENSG00000125733
Pharos: Q15642(Tbio)
UniProt: Q15642
Structure
LinkDB
Position
19:6739680..6751530
AA seq 601 aa
MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAK
DDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEG
RRAQQQLENGFKQLENSKRKFERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRS
HMAEESKNEYAAQLQRFNRDQAHFYFSQMPQIFDKLQDMDERRATRLGAGYGLLSEAELE
VVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPGDVEFEDFSQPMNRAPSDSSL
GTPSDGRPELRGPGRSRTKRWPFGKKNKPRPPPLSPLGGPVPSALPNGPPSPRSGRDPLA
ILSEISKSVKPRLASFRSLRGSRGTVVTEDFSHLPPEQQRKRLQQQLEERSRELQKEVDQ
REALKKMKDVYEKTPQMGDPASLEPQIAETLSNIERLKLEVQKYEAWLAEAESRVLSNRG
DSLSRHARPPDPPASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTS
PIGHCVAIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
N
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggattggggcactgagctgtgggatcagttcgaggtgctcgagcgccacacgcagtgg
gggctggacctgttggacagatatgtaaagttcgtgaaagaacgcaccgaagtggaacag
gcttacgccaaacaactgcggagcctggtgaaaaaatatctgcccaagagacctgccaag
gatgatcctgagtccaaattcagccagcaacagtccttcgtacagattctccaggaggtg
aatgactttgcaggccagcgggagctggtggctgagaacctcagtgtccgtgtatgtctt
gagctgaccaagtactcacaagagatgaaacaggagaggaagatgcacttccaagaaggg
cggcgggcccagcagcagctggaaaatggctttaaacagctggagaatagtaagcgtaaa
tttgagcgggactgccgggaggcagagaaggcagcccagactgctgaacggctagaccag
gatatcaacgccaccaaggctgatgtggagaaggccaagcagcaagcccaccttcggagt
cacatggccgaagaaagcaaaaacgaatatgcggctcaactgcagcgcttcaaccgagac
caagcccacttctatttttcacagatgccccagatattcgataagctccaagacatggat
gaacgcagggccacccgcctgggtgccgggtatgggctcctgtcggaggccgagctggag
gtggtgcccataatagccaagtgcttggagggcatgaaggtggctgcaaatgctgtggat
cccaagaacgactcccacgtccttatagagctgcacaagtcaggttttgcccgcccgggc
gacgtggaattcgaggacttcagccagcccatgaaccgtgcaccctccgacagcagtctg
ggcaccccctcggatggacggcctgaactccgaggcccgggtcgcagccgcaccaagcgc
tggccttttggcaagaagaacaagcctcgccccccacccctctcccccctggggggcccc
gtaccctcggcattgcctaacggacccccgtccccccgctccggccgtgaccccttggcc
atactgagcgagatcagtaagtcggtcaaaccgaggctagcatccttccgcagccttcga
ggcagccgtgggacagtggtgaccgaggattttagccacttgcccccagagcagcagcga
aaacggcttcaacagcagttggaagaacgcagtcgtgaacttcagaaggaggttgaccag
agggaagccctaaagaaaatgaaggatgtctatgagaagacacctcagatgggggacccc
gccagcttggagccccagatcgctgaaaccctgagcaacattgaacggctgaaattggaa
gtgcagaagtatgaggcgtggctggcagaagctgaaagtcgagtccttagcaaccgggga
gacagcctgagccggcacgcccggcctcccgacccccccgctagcgccccgccagacagc
agcagcaacagcgcatcacaggacaccaaggagagctctgaagagcctccctcagaagag
agccaggacacccccatttacacggagtttgatgaggatttcgaggaggaacccacatcc
cccataggtcactgtgtggccatctaccactttgaagggtccagcgagggcactatctct
atggccgagggtgaagacctcagtcttatggaagaagacaaaggggacggctggacccgg
gtcaggcggaaagagggaggcgagggctacgtgcccacctcctacctccgagtcacgctc
aattga

DBGET integrated database retrieval system