KEGG   Homo sapiens (human): 9407
Entry
9407              CDS       T01001                                 
Symbol
TMPRSS11D, ASP, HAT
Name
(RefSeq) transmembrane serine protease 11D
  KO
K09641  transmembrane protease serine 11D [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    9407 (TMPRSS11D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    9407 (TMPRSS11D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     9407 (TMPRSS11D)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   9407 (TMPRSS11D)
SSDB
Motif
Pfam: Trypsin SEA Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 9407
NCBI-ProteinID: NP_004253
OMIM: 605369
HGNC: 24059
Ensembl: ENSG00000153802
Vega: OTTHUMG00000129300
Pharos: O60235(Tchem)
UniProt: O60235
LinkDB
Position
4:complement(67820876..67884002)
AA seq 418 aa
MYRPARVTSTSRFLNPYVVCFIVVAGVVILAVTIALLVYFLAFDQKSYFYRSSFQLLNVE
YNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRAHVAKLRQDGSGVRADVVMKF
QFTRNNNGASMKSRIESVLRQMLNNSGNLEINPSTEITSLTDQAAANWLINECGAGPDLI
TLSEQRILGGTEAEEGSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNSNPRDWIA
TSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVCLPAATQNI
PPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVCNAPHSYNGAILSGMLCAGVPQGG
VDACQGDSGGPLVQEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWIRQQTGI
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgtataggccagcacgtgtaacttcgacttcaagatttctgaatccatatgtagtatgt
ttcattgtcgtcgcaggggtagtgatcctggcagtcaccatagctctacttgtttacttt
ttagcttttgatcaaaaatcttacttttataggagcagttttcaactcctaaatgttgaa
tataatagtcagttaaattcaccagctacacaggaatacaggactttgagtggaagaatt
gaatctctgattactaaaacattcaaagaatcaaatttaagaaatcagttcatcagagct
catgttgccaaactgaggcaagatggtagtggtgtgagagcggatgttgtcatgaaattt
caattcactagaaataacaatggagcatcaatgaaaagcagaattgagtctgttttacga
caaatgctgaataactctggaaacctggaaataaacccttcaactgagataacatcactt
actgaccaggctgcagcaaattggcttattaatgaatgtggggccggtccagacctaata
acattgtctgagcagagaatccttggaggcactgaggctgaggagggaagctggccgtgg
caagtcagtctgcggctcaataatgcccaccactgtggaggcagcctgatcaataacatg
tggatcctgacagcagctcactgcttcagaagcaactctaatcctcgtgactggattgcc
acgtctggtatttccacaacatttcctaaactaagaatgagagtaagaaatattttaatt
cataacaattataaatctgcaactcatgaaaatgacattgcacttgtgagacttgagaac
agtgtcacctttaccaaagatatccatagtgtgtgtctcccagctgctacccagaatatt
ccacctggctctactgcttatgtaacaggatggggcgctcaagaatatgctggccacaca
gttccagagctaaggcaaggacaggtcagaataataagtaatgatgtatgtaatgcacca
catagttataatggagccatcttgtctggaatgctgtgtgctggagtacctcaaggtgga
gtggacgcatgtcagggtgactctggtggcccactagtacaagaagactcacggcggctt
tggtttattgtggggatagtaagctggggagatcagtgtggcctgccggataagccagga
gtgtatactcgagtgacagcctaccttgactggattaggcaacaaactgggatctag

DBGET integrated database retrieval system