KEGG   Homo sapiens (human): 9416
Entry
9416              CDS       T01001                                 
Symbol
DDX23, PRPF28, SNRNP100, U5-100K, U5-100KD, prp28
Name
(RefSeq) DEAD-box helicase 23
  KO
K12858  ATP-dependent RNA helicase DDX23/PRP28 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9416 (DDX23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9416 (DDX23)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9416 (DDX23)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    9416 (DDX23)
 Complex C
   U5 SnRNP specific factors
    9416 (DDX23)
SSDB
Motif
Pfam: DEAD Helicase_C AAA_19 ResIII DUF3698
Other DBs
NCBI-GeneID: 9416
NCBI-ProteinID: NP_004809
OMIM: 612172
HGNC: 17347
Ensembl: ENSG00000174243
Pharos: Q9BUQ8(Tbio)
UniProt: Q9BUQ8 A0A024R0Z3 B3KY11
Structure
LinkDB
Position
12:complement(48829756..48852163)
AA seq 820 aa
MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSR
SRSRSKSAERERRHKERERDKERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRK
DRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAKPKFLSKAEREAEALKRRQQE
VEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREE
KDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLG
RGFIAGIDLKQQKREQSRFYGDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQK
KLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPPHILEVIDKCGYKEPTPIQRQ
AIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTREL
AQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVL
SRCTYVVLDEADRMIDMGFEPDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYR
QTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVEQKVFLMSESEKRKKLLAILE
QGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVA
TDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELK
QAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggcaggagagctggctgacaaaaaggaccgtgatgcatcaccttccaaggaggaaagg
aagcgatcacggactcctgacagagagcgggatagagaccgggaccggaagtcttcccca
tctaaagatagaaagcggcatcgttcaagggatagacgtcgaggaggcagccgttctcgc
tctcgttcccgttccaaatctgcagaaagagaacgacggcacaaagaacgagaacgagat
aaggagcgggatcggaataagaaggaccgagatcgagacaaggatgggcacagacgggac
aaggaccgtaaacgatccagcttatctcctggtcgaggaaaagactttaaatctcggaag
gacagagactctaagaaggatgaagaggatgaacatggtgataagaagcctaaggcccag
ccattatccctggaggagcttctggccaagaaaaaggctgaggaagaagctgaggctaag
cccaagttcctctctaaagcagaacgagaggctgaagctctaaagcgacggcagcaggag
gtggaagagcggcagaggatgcttgaagaagagaggaagaaaaggaaacagttccaagac
ttgggcaggaagatgttggaagatcctcaggaacgggaacgtcgggaacgcagggagagg
atggaacgggagaccaatggaaatgaggatgaggaagggcggcagaagatccgggaagag
aaggataagagcaaggaactgcatgccattaaggagcgttacctgggtggcatcaaaaag
cggcgccgaacgagacatctcaatgaccggaaatttgtttttgagtgggatgcatctgag
gacacatccattgactacaaccccctgtacaaagaacggcaccaggtgcagttgttaggg
cgaggcttcattgcaggcattgacctcaagcagcagaagcgagagcagtcacgtttctat
ggagacctaatggagaagaggcgaaccctggaagaaaaggagcaggaggaggcaagactc
cgcaaacttcgtaagaaggaagccaagcagcgctgggatgatcgtcattggtctcagaaa
aagttagatgagatgacggacagggactggcggatcttccgtgaggactacagcatcacc
accaaaggtggcaagatccccaatcccatccgatcctggaaagactcttctctgccccca
cacatcttggaggtcattgataagtgtggctacaaggaaccaacacctatacagcgtcag
gcaattcccattgggctacagaatcgtgacatcattggtgtggctgagactggcagtggc
aagacagcagccttcctcatccctctgctggtctggatcaccacacttcccaaaattgac
aggatcgaagagtcagaccaaggcccttatgccatcatcctggctcccacccgtgagttg
gctcaacagattgaggaagagaccatcaagtttgggaaaccgctaggtatccgcactgtg
gctgtcattggtggcatctccagagaagaccagggcttcaggctgcgcatgggttgtgag
attgtgattgctacccctgggcgtttgattgatgtgctggagaaccgctacctggtgctg
agccgctgtacctatgtggttctggatgaggcagataggatgattgacatgggctttgag
ccagatgtccagaagatcctggagcacatgcctgtcagcaaccagaagccagacacggat
gaggctgaggaccctgagaagatgctggccaactttgagtcgggaaaacataagtaccgc
caaacagtcatgttcacggccaccatgcccccagcggtggagcgtctggccaggagctat
cttcggcgacctgctgtggtgtacattggctccgcaggcaagccccatgagcgtgtggaa
cagaaggtcttcctcatgtcagagtcagaaaagaggaaaaagctgctggcaatcttggag
caaggctttgacccacccatcattatttttgtcaaccagaagaagggctgcgacgtgttg
gccaaatccctggagaagatggggtacaatgcttgcacactgcacggtggaaaaggccag
gagcagcgagagtttgcgttgtccaacctcaaggctggggccaaggatattttggtggct
acagatgtggctggtcgtggtattgacatccaagatgtgtctatggttgtcaactatgat
atggccaaaaatattgaagattacatccaccgcattggccgcacgggacgagcaggcaag
agtggggtggccatcaccttcctcacaaaagaggactctgctgtgttctacgagctgaag
caagctatcctggaaagcccagtgtcttcctgtccccccgaactagccaaccacccagat
gcccagcataagccaggcaccatcctcaccaagaagcgccgggaagagaccatctttgcc
tga

DBGET integrated database retrieval system