KEGG   Homo sapiens (human): 9500
Entry
9500              CDS       T01001                                 
Symbol
MAGED1, DLXIN-1, NRAGE
Name
(RefSeq) MAGE family member D1
  KO
K12464  melanoma-associated antigen D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    9500 (MAGED1)
SSDB
Motif
Pfam: MAGE
Other DBs
NCBI-GeneID: 9500
NCBI-ProteinID: NP_001005332
OMIM: 300224
HGNC: 6813
Ensembl: ENSG00000179222
Pharos: Q9Y5V3(Tbio)
UniProt: Q9Y5V3
LinkDB
Position
X:51803076..51902354
AA seq 778 aa
MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQISEAPPTNQATAAASPQSSQPPTAN
EMADIQVSAAAARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPK
GPNAAYDFSQAATTGELAANKSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTP
FKAWNDTTKAPTADTQTQNVNQAKMATSQADIETDPGISEPDGATAQTSADGSQAQNLES
RTIIRGKRTRKINNLNVEENSSGDQRRAPLAAGTWRSAPVPVTTQNPPGAPPNVLWQTPL
AWQNPSGWQNQTARQTPPARQSPPARQTPPAWQNPVAWQNPVIWPNPVIWQNPVIWPNPI
VWPGPVVWPNPLAWQNPPGWQTPPGWQTPPGWQGPPDWQGPPDWPLPPDWPLPPDWPLPT
DWPLPPDWIPADWPIPPDWQNLRPSPNLRPSPNSRASQNPGAAQPRDVALLQERANKLVK
YLMLKDYTKVPIKRSEMLRDIIREYTDVYPEIIERACFVLEKKFGIQLKEIDKEEHLYIL
ISTPESLAGILGTTKDTPKLGLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPLL
GDLRKLLTYEFVKQKYLDYRRVPNSNPPEYEFLWGLRSYHETSKMKVLRFIAEVQKRDPR
DWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEAVSGPWSWDDIEFELLTWDEE
GDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFGAIGFFWVE
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggctcagaaaatggactgtggtgcgggcctcctcggcttccaggctgaggcctccgta
gaagacagcgccttgcttatgcagaccttgatggaggccatccagatctcagaggctcca
cctactaaccaggccaccgcagctgctagtccccagagttcacagcccccaactgccaat
gagatggctgacattcaggtttcagcagctgccgctaggcctaagtcagcctttaaagtc
cagaatgccaccacaaaaggcccaaatggtgtctatgatttctctcaggctcataatgcc
aaggatgtgcccaacacgcagcccaaggcagcctttaagtcccaaaatgctaccccaaag
ggtccaaatgctgcctatgatttttcccaggcagcaaccactggtgagttagctgctaac
aagtctgagatggccttcaaggcccagaatgccactactaaagtgggcccaaatgccacc
tacaatttctctcagtctctcaatgccaatgacctggccaacagcaggcctaagacccct
ttcaaggcttggaatgataccactaaggccccaacagctgatacccagacccagaatgta
aatcaggccaaaatggccacttcccaggctgacatagagaccgacccaggtatctctgaa
cctgacggtgcaactgcacagacatcagcagatggttcccaggctcagaatctggagtcc
cggacaataattcggggcaagaggacccgcaagattaataacttgaatgttgaagagaac
agcagtggggatcagaggcgggccccactggctgcagggacctggaggtctgcaccagtt
ccagtgaccactcagaacccacctggcgcaccccccaatgtgctctggcagacgccattg
gcttggcagaacccctcaggctggcaaaaccagacagccaggcagaccccaccagcacgt
cagagccctccagctaggcagaccccaccagcctggcagaacccagtcgcttggcagaac
ccagtgatttggccaaacccagtaatctggcagaacccagtgatctggccaaaccccatt
gtctggcccggccctgttgtctggccgaatccactggcctggcagaatccacctggatgg
cagactccacctggatggcagaccccaccgggctggcagggtcctccagactggcaaggt
cctcctgactggccgctaccacccgactggccactgccacctgattggccacttcccact
gactggccactaccacctgactggatccccgctgattggccaattccacctgactggcag
aacctgcgcccctcgcctaacctgcgcccttctcccaactcgcgtgcctcacagaaccca
ggtgctgcacagccccgagatgtggcccttcttcaggaaagagcaaataagttggtcaag
tacttgatgcttaaggactacacaaaggtgcccatcaagcgctcagaaatgctgagagat
atcatccgtgaatacactgatgtttatccagaaatcattgaacgtgcatgctttgtccta
gagaagaaatttgggattcaactgaaagaaattgacaaagaagaacacctgtatattctc
atcagtacccccgagtccctggctggcatactgggaacgaccaaagacacacccaagctc
ggtctcctcttggtgattctgggtgtcatcttcatgaatggcaaccgtgccagtgaggct
gtcctctgggaggcactacgcaagatgggactgcgtcctggggtgagacatcccctcctt
ggagatctaaggaaacttctcacctatgagtttgtaaagcagaaatacctggactacaga
cgagtgcccaacagcaaccccccggagtatgagttcctctggggcctccgttcctaccat
gagactagcaagatgaaagtgctgagattcattgcagaggttcagaaaagagaccctcgt
gactggactgcacagttcatggaggctgcagatgaggccttggatgctctggatgctgct
gcagctgaggccgaagcccgggctgaagcaagaacccgcatgggaattggagatgaggct
gtgtctgggccctggagctgggatgacattgagtttgagctgctgacctgggatgaggaa
ggagattttggagatccctggtccagaattccatttaccttctgggccagataccaccag
aatgcccgctccagattccctcagacctttgccggtcccattattggtcctggtggtaca
gccagtgccaacttcgctgccaactttggtgccattggtttcttctgggttgagtga

DBGET integrated database retrieval system