KEGG   Homo sapiens (human): 9547
Entry
9547              CDS       T01001                                 
Symbol
CXCL14, BMAC, BRAK, KEC, KS1, MIP-2g, MIP2G, NJAC, SCYB14
Name
(RefSeq) C-X-C motif chemokine ligand 14
  KO
K10033  C-X-C motif chemokine 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01255  VAV CrmB to CXCR signaling
N01256  HSV1 SgG1 to CXCR signaling
N01257  HSV2 SgG2 to CXCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    9547 (CXCL14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    9547 (CXCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    9547 (CXCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    9547 (CXCL14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   9547 (CXCL14)
SSDB
Motif
Pfam: IL8 DUF6355
Other DBs
NCBI-GeneID: 9547
NCBI-ProteinID: NP_004878
OMIM: 604186
HGNC: 10640
Ensembl: ENSG00000145824
Pharos: O95715(Tbio)
UniProt: O95715
Structure
LinkDB
Position
5:complement(135570679..135578991)
AA seq 99 aa
MRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT
KSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaggctcctggcggccgcgctgctcctgctgctgctggcgctgtacaccgcgcgtgtg
gacgggtccaaatgcaagtgctcccggaagggacccaagatccgctacagcgacgtgaag
aagctggaaatgaagccaaagtacccgcactgcgaggagaagatggttatcatcaccacc
aagagcgtgtccaggtaccgaggtcaggagcactgcctgcaccccaagctgcagagcacc
aagcgcttcatcaagtggtacaacgcctggaacgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system