KEGG   Homo sapiens (human): 9775
Entry
9775              CDS       T01001                                 
Symbol
EIF4A3, DDX48, Fal1, MUK34, NMP265, NUK34, RCPS, eIF-4A-III, eIF4A-III, eIF4AIII
Name
(RefSeq) eukaryotic translation initiation factor 4A3
  KO
K13025  ATP-dependent RNA helicase [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Disease
H02503  Richieri-Costa-Pereira syndrome
Drug target
Zotatifin: D11837
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9775 (EIF4A3)
  09122 Translation
   03013 Nucleocytoplasmic transport
    9775 (EIF4A3)
   03015 mRNA surveillance pathway
    9775 (EIF4A3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    9775 (EIF4A3)
   03041 Spliceosome [BR:hsa03041]
    9775 (EIF4A3)
   03009 Ribosome biogenesis [BR:hsa03009]
    9775 (EIF4A3)
   03012 Translation factors [BR:hsa03012]
    9775 (EIF4A3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9775 (EIF4A3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     9775 (EIF4A3)
   mRNA cycle factors
    Stress granule specific factors
     9775 (EIF4A3)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    9775 (EIF4A3)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   Helicases
    9775 (EIF4A3)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    9775 (EIF4A3)
SSDB
Motif
Pfam: DEAD Helicase_C AAA_19 AAA_30 ResIII AAA_22 Flavi_DEAD
Other DBs
NCBI-GeneID: 9775
NCBI-ProteinID: NP_055555
OMIM: 608546
HGNC: 18683
Ensembl: ENSG00000141543
Pharos: P38919(Tbio)
UniProt: P38919 A0A024R8W0
Structure
LinkDB
Position
17:complement(80134369..80147128)
AA seq 411 aa
MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEK
PSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAV
QIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRA
IKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRIL
VKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA
NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNREL
YIHRIGRSGRYGRKGVAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggcgaccacggccacgatggcgacctcgggctcggcgcgaaagcggctgctcaaagag
gaagacatgactaaagtggaattcgagaccagcgaggaggtggatgtgacccccacgttc
gacaccatgggcctgcgggaggacctgctgcggggcatctacgcttacggttttgaaaaa
ccatcagcaatccagcaacgagcaatcaagcagatcatcaaagggagagatgtcatcgca
cagtctcagtccggcacaggaaaaacagccaccttcagtatctcagtcctccagtgtttg
gatattcaggttcgtgaaactcaagctttgatcttggctcccacaagagagttggctgtg
cagatccagaaggggctgcttgctctcggtgactacatgaatgtccagtgccatgcctgc
attggaggcaccaatgttggcgaggacatcaggaagctggattacggacagcatgttgtc
gcgggcactccagggcgtgtttttgatatgattcgtcgcagaagcctaaggacacgtgct
atcaaaatgttggttttggatgaagctgatgaaatgttgaataaaggtttcaaagagcag
atttacgatgtatacaggtacctgcctccagccacacaggtggttctcatcagtgccacg
ctgccacacgagattctggagatgaccaacaagttcatgaccgacccaatccgcatcttg
gtgaaacgtgatgaattgactctggaaggcatcaagcaatttttcgtggcagtggagagg
gaagagtggaaatttgacactctgtgtgacctctacgacacactgaccatcactcaggcg
gtcatcttctgcaacaccaaaagaaaggtggactggctgacggagaaaatgagggaagcc
aacttcactgtatcctcaatgcatggagacatgccccagaaagagcgggagtccatcatg
aaggagttccggtcgggcgccagccgagtgcttatttctacagatgtctgggccaggggg
ttggatgtccctcaggtgtccctcatcattaactatgatctccctaataacagagaattg
tacatacacagaattgggagatcaggtcgatacggccggaagggtgtggccattaacttt
gtaaagaatgacgacatccgcatcctcagagatatcgagcagtactattccactcagatt
gatgagatgccgatgaacgttgctgatcttatctga

DBGET integrated database retrieval system