KEGG   Homo sapiens (human): 9815
Entry
9815              CDS       T01001                                 
Symbol
GIT2, CAT-2, CAT2, PKL
Name
(RefSeq) GIT ArfGAP 2
  KO
K12487  G protein-coupled receptor kinase interactor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05135  Yersinia infection
Network
nt06180  Pathogenic Escherichia coli
nt06182  Shigella
  Element
N01070  ITGA/B-FAK-CDC42 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9815 (GIT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    9815 (GIT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9815 (GIT2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9815 (GIT2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9815 (GIT2)
SSDB
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_4 Ank Ank_5 TTRAP Shugoshin_N DMPK_coil GAS YabA
Other DBs
NCBI-GeneID: 9815
NCBI-ProteinID: NP_476510
OMIM: 608564
HGNC: 4273
Ensembl: ENSG00000139436
UniProt: Q14161
LinkDB
Position
12:complement(109929804..110000164)
AA seq 759 aa
MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
SLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAT
TNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDME
PDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPG
DPGSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgtcgaaacggctccggagcagcgaggtgtgcgctgactgcagcgggccggatccttcc
tgggcatcagtaaataggggaacgtttttatgtgatgagtgctgcagtgtccatcggagt
ctagggcgccatatctcccaagtgaggcatctgaaacacacaccgtggcctccaacactg
cttcagatggttgagaccttgtataataacggtgctaactctatatgggagcattctttg
ctggaccctgcgtctattatgagtggaagacgtaaagctaatccacaggataaagtacat
cccaataaagcggaattcatcagagccaagtatcagatgttagcgttcgtccatcgcttg
ccctgccgggatgacgatagtgtgactgccaaagatcttagcaagcaactccattcgagc
gtgagaacagggaatcttgaaacctgtttgagactgttatctttaggagcacaagccaac
ttctttcatcctgaaaaaggaaacaccccactccatgttgcctccaaagcagggcagatt
ttacaggctgaattattggcagtatatggagcagacccaggcacacaggattctagtggg
aaaactcccgttgattatgcaaggcaaggagggcaccatgagctggcagagcgcctcgtg
gaaatacagtatgagctaacggacagactagccttctatctctgtggcaggaaaccagat
cacaaaaatggacagcactttataatacctcaaatggcagacagcagcctggatttgtct
gaattggcaaaagctgctaagaagaaacttcaatctctaagtaatcatttgtttgaagaa
cttgccatggatgtgtacgatgaagttgacaggcgagagacggatgcagtctggcttgcc
acgcaaaaccacagcgccctggtaaccgagacaacggtcgtcccctttcttccggtcaat
cctgagtactcatcaacacgaaatcagggcagacagaagttagctcggttcaacgcccat
gagtttgccacgctggtcattgacattctcagtgacgccaagaggagacagcagggcagt
tctctctcgggttcaaaagacaatgtggagctcatactgaaaaccatcaataaccagcac
agcgttgagagtcaagacaacgatcagcccgactatgacagcgtggcatcagacgaagac
acagatttggaaaccactgcaagcaaaacaaaccggcagaagagcctagattcagattta
tcagatggaccagtcactgtacaggaatttatggaggtcaaaaacgctctagtggcttct
gaggccaagatacagcagctaatgaaggtgaataacaacttgagtgacgagctgagaatt
atgcagaaaaagcttcaaacactccagagtgaaaattcgaacctcaggaaacaggccaca
accaatgtatatcaggtgcaaactggttctgagtacacagacacttccaaccactcttcc
ttaaagagacgtccgtctgcccggggcagtaggcccatgtccatgtacgagaccggatca
ggtcagaaaccatatctcccaatgggagaagcgagccgccccgaagagagcaggatgaga
ctccagcccttccccgcgcacatcgggaggagtgcacttgtgacctcctcttcatctctg
ccttccttcccctccacactttcctggtcgagggacgaaagcgcccgaagggcatccagg
ctggagaagcagaacagcacacctgagagtgactacgacaacactcccaacgacatggag
ccagatggcatggggtcaagccgaaagggacggcaaagaagtatggtgtggccaggggat
ggcttggtaccagacacagcagaaccccatgtggccccaagccccactctccctagcacc
gaagatgtcatcaggaagactgaacagatcaccaaaaacatacaggagctcttaagagca
gcccaagaaaataaacatgacagttatattccctgctcagagaggatacacgtagctgtt
acagaaatggcagcattattccccaaaaaacccaagtctgatatggtgaggacttccctt
cgtttactgacgtccagtgcctaccgactgcagtcagagtgcaagaagaccctcccaggg
gaccccggctcacccacagacgttcagctggtcacgcagcaggtcatccagtgtgcgtac
gacatcgccaaggctgccaagcagctggttaccatcaccaccaaagagaacaacaactga

KEGG   Homo sapiens (human): 8874
Entry
8874              CDS       T01001                                 
Symbol
ARHGEF7, BETA-PIX, COOL-1, COOL1, Nbla10314, P50, P50BP, P85, P85COOL1, P85SPR, PAK3, PIXB
Name
(RefSeq) Rho guanine nucleotide exchange factor 7
  KO
K13710  Rho guanine nucleotide exchange factor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
hsa05135  Yersinia infection
Network
nt06180  Pathogenic Escherichia coli
nt06182  Shigella
  Element
N01070  ITGA/B-FAK-CDC42 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    8874 (ARHGEF7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    8874 (ARHGEF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8874 (ARHGEF7)
Membrane trafficking [BR:hsa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    8874 (ARHGEF7)
SSDB
Motif
Pfam: RhoGEF67_u2 RhoGEF SH3_2 SH3_1 SH3_9 RhoGEF67_u1 PH CH
Other DBs
NCBI-GeneID: 8874
NCBI-ProteinID: NP_001106983
OMIM: 605477
HGNC: 15607
Ensembl: ENSG00000102606
UniProt: Q14155 Q5W9H1
Structure
LinkDB
Position
13:111114619..111305734
AA seq 803 aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEP
RSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNK
VLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMT
DNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVRE
VKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRP
LQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTL
YLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKEL
ERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNV
TYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSE
NHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSH
PVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPP
LRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAY
CTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIW
TAHSYRMGSTSRKSCCSYISHQN
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgaattccgccgagcaaaccgttacgtggctcatcactctgggggtgctggagtcgccc
aaaaaaaccatctcggacccggagggctttctgcaggcgtcgctgaaggatggggtggtc
ctctgcaggctgctggagcgcctgctccccgggaccatcgagaaagtctaccccgagccc
cggagcgagagcgagtgcctgagcaacatccgcgagttcctgcgcggctgcggggcttcc
ctgcggctggagctcctgtttcctccttcccagcctcctcagcatctggtaaccaccatt
ctcttgtctgcttctacgtttgatgcaaatgatttgtatcaggggcagaattttaacaag
gtcctcagttccttagtgactctaaataaagtaacagcagacatcgggctggggagtgac
tccgtgtgtgcccggccctcgtctcaccgcataaagtcttttgactcccttggatcacag
tctttgcacactcggacttcaaaactgttccagggccagtatcggagtttggacatgacc
gataatagcaacaatcaactggtagtaagagcaaagtttaacttccagcagaccaatgag
gacgagctttccttctcaaaaggagacgtcatccatgtcacccgtgtggaagagggaggc
tggtgggagggcacactcaacggccggaccggctggttccccagcaactacgtgcgcgag
gtcaaggccagcgagaagcctgtgtctcccaaatcaggaacactgaagagccctcccaaa
ggatttgatacgactgccataaacaaaagctattacaatgtggtgctacagaatatttta
gaaacagaaaatgaatattctaaagaacttcagactgtgctttcaacgtacctacggcca
ttgcagaccagtgagaagttaagttcagcaaacatttcatatttaatgggaaatctagaa
gaaatatgttctttccagcaaatgctcgtacagtctttagaagaatgcaccaagttgccc
gaagctcagcagagagtcggaggctgctttttaaacctgatgccacagatgaaaaccctg
tacctcacgtattgtgccaatcacccttctgcagtgaatgtcctcacggaacacagtgag
gagttgggggagttcatggagaccaaaggtgccagcagccctgggattctcgtgctgacc
acgggcctgagcaaacccttcatgcgcctggataaataccctacgctgctcaaagagctc
gagagacacatggaggattatcatacagatagacaagatattcaaaaatccatggctgcc
ttcaaaaacctttcagcccaatgtcaagaagtccggaagaggaaagagcttgagctgcag
atcctgacggaagccatccggaactgggagggcgatgacattaaaactctgggcaacgtc
acttacatgtcccaggtcctgattcagtgtgccggaagtgaggaaaagaatgaaagatat
cttctactcttcccaaatgttttgctaatgttgtctgccagtcctaggatgagtggcttt
atctatcagggaaagcttccaacgacaggaatgacaatcacaaagcttgaggacagtgaa
aatcatagaaatgcatttgaaatatcagggagcatgattgagcggatattagtgtcgtgc
aacaaccagcaggatctgcaggaatgggtggagcacctacagaagcaaacgaaggtcacg
tctgtgggaaaccccaccataaagcctcattcagtgccatctcataccctcccctcccac
ccggtcactccgtccagcaagcacgcagacagcaagcccgcgccgctgacgcccgcctac
cacacgctgccccacccctcccaccacggcaccccgcacaccaccatcaactggggaccc
ctggagcctccgaaaacacccaagccctggagcctgagctgcctgcggcccgcgcctccc
ctccggccctcagctgctctctgctacaaggaggatcttagtaagagccctaagaccatg
aaaaagctgctgcccaagcgcaaacctgaacggaagccttcagatgaggagttcgcgtcc
cggaaaagcacagctgctttggaagaagatgctcagattctgaaagtcattgaagcttac
tgcaccagcgccaaaacaaggcaaacactcaattcaacatggcaaggcactgacctgatg
cataatcacgtcttggctgatgatgaccaaccaagcctagactccctggggcgtcgcagt
agcctttctcgtttggagccttcagacctctcggaagactctgactatgacagtatatgg
acagcccatagttacagaatgggttctacatctcgtaagagctgttgctcatatatctct
caccagaactaa

DBGET integrated database retrieval system