KEGG   Homo sapiens (human): 9879
Entry
9879              CDS       T01001                                 
Symbol
DDX46, PRPF5, Prp5
Name
(RefSeq) DEAD-box helicase 46
  KO
K12811  ATP-dependent RNA helicase DDX46/PRP5 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    9879 (DDX46)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9879 (DDX46)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     9879 (DDX46)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    9879 (DDX46)
 Complex B
    9879 (DDX46)
SSDB
Motif
Pfam: DEAD Helicase_C CdAMP_rec
Other DBs
NCBI-GeneID: 9879
NCBI-ProteinID: NP_055644
OMIM: 617848
HGNC: 18681
Ensembl: ENSG00000145833
Pharos: Q7L014(Tbio)
UniProt: Q7L014
Structure
LinkDB
Position
5:134758779..134831121
AA seq 1031 aa
MGRESRHYRKRSASRGRSGSRSRSRSPSDKRSKRGDDRRSRSRDRDRRRERSRSRDKRRS
RSRDRKRLRRSRSRERDRSRERRRSRSRDRRRSRSRSRGRRSRSSSPGNKSKKTENRSRS
KEKTDGGESSKEKKKDKDDKEDEKEKDAGNFDQNKLEEEMRKRKERVEKWREEQRKKAME
NIGELKKEIEEMKQGKKWSLEDDDDDEDDPAEAEKEGNEMEGEELDPLDAYMEEVKEEVK
KFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAMEYSSEEEE
VDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGI
TVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGS
GKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVY
GGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFE
PQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVI
EEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDS
IINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAY
TFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKF
DETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPA
PTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQL
AEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISE
YSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSY
QPTNKGRYKVL
NT seq 3096 nt   +upstreamnt  +downstreamnt
atgggtcgggagtcacgccactatcgaaaacgatcggcatcccggggtcgctctggaagt
cggtctagaagtcgctcaccctcagacaaaagaagtaaacgtggagatgacagacggtct
agaagtagagatagagataggaggagagagaggtctcgtagcagggataaaagaagatct
cggtcaagggacaggaagcgtctgagacgttccagaagtagagagagagacagaagccga
gagcgaagaagatctcgaagtagagacaggagacgctcaaggagtagaagccggggccgg
cgatcccgatcctccagtcctggaaataaaagcaagaaaactgagaatagatctaggtcc
aaagagaaaactgatggtggggaaagttctaaagagaagaaaaaagacaaagatgacaag
gaggatgaaaaagaaaaagatgctggcaactttgaccagaataagctggaagaagaaatg
agaaagcgaaaagaaagagtagaaaaatggcgagaagagcaacgtaaaaaggctatggaa
aacataggagaactgaaaaaggaaatcgaagagatgaaacaagggaaaaagtggagttta
gaggacgatgatgatgacgaagatgatcctgcagaagctgaaaaggagggaaatgaaatg
gagggtgaggagttagatccattagatgcttacatggaagaagtgaaagaggaagtaaaa
aaatttaacatgagaagtgtaaaaggtggtgggggaaatgaaaagaagtctgggccaacg
gtcacaaaagttgtcactgttgtgacaaccaaaaaagcagttgtggattctgataagaag
aaaggtgagctgatggagaatgaccaggatgccatggagtattcttcagaggaggaagaa
gttgatcttcagacagcccttacagggtatcaaacaaaacagcgaaagcttctagaacca
gttgatcatggaaaaattgagtatgagccatttaggaaaaacttctatgttgaagttcca
gaactagcaaaaatgtctcaagaagaggtaaatgtgtttcgattggaaatggagggcatt
acagttaaaggaaaaggttgccccaaaccaattaaatcctgggtccagtgtggaatttcc
atgaagatcttaaattccctcaagaagcatggctatgaaaagcccacgcccatccaaacc
caagctattcctgctataatgtctggacgagatttgattggcattgccaaaacaggaagt
ggaaagaccattgcttttctgttgcccatgtttagacacatcatggatcagaggtcatta
gaggaaggagaggggccaatagctgtcatcatgactccaactcgagaactggctttacag
attactaaagagtgtaagaagttttccaagactttgggacttagagtggtctgtgtttac
ggaggaacaggaatcagtgagcagattgctgagctgaaaagaggtgctgaaattattgtt
tgcacacctggtcgaatgattgacatgttagccgctaacagtggtcgggtcacaaatctt
cgaagagtgacatatgttgttttagatgaagcagacagaatgtttgacatgggttttgaa
ccccaggtcatgcgcatcgtggataatgttcgtcctgatcgacagacggttatgttttca
gctactttccccagagctatggaggctttggctcgcaggatcctcagtaaacctattgaa
gtacaagttggaggcaggagtgtggtttgctcagatgtggagcaacaagtgattgtgatt
gaagaagaaaagaaattcttgaagttacttgagcttctaggccattatcaagagtcagga
tctgtcattatatttgtggataagcaggaacatgctgatggtcttcttaaggatttaatg
agagcatcttatccttgcatgtctcttcatggaggcattgatcaatatgacagagatagc
atcataaatgactttaagaatgggacctgcaaacttcttgtggctacctctgttgctgcc
cgaggtctagatgtgaaacatctgattcttgtagtaaattatagctgccccaaccattat
gaggattatgtacacagagcagggcggactggaagagcaggaaacaagggttatgcttat
acttttatcacagaggatcaagctcgctatgctggtgacataattaaagctcttgaattg
tcagggactgcagtacctcctgatttagagaaactgtggagtgatttcaaagatcagcag
aaagctgaggggaaaataattaaaaagagtagtgggttctctggtaagggattcaagttt
gatgaaacagaacaagctttggctaatgagaggaagaagttacaaaaagcagctcttggt
ctacaagattcagatgatgaggatgctgcagttgatattgatgagcaaattgaaagcatg
tttaattcaaagaagagagtaaaggatatggctgctcctggaacatcaagtgttcctgct
ccaactgcaggaaatgctgagaaattagaaattgctaagagattggctcttagaatcaat
gcccagaagaatttgggcatcgagtctcaggatgtgatgcagcaggccaccaatgcaatt
cttaggggtggcaccattctggctcccactgtttctgcaaaaaccattgcagaacaactt
gctgaaaagatcaatgccaagctcaattatgtgccgttagagaaacaagaagaagagaga
caggatggtggacagaatgaatcttttaagagatatgaagaagaattagagatcaatgac
ttcccacagactgctaggtggaaagttacctctaaggaagctctgcagagaatcagtgaa
tactctgaagccgcaattacaatcagaggaacctacttccctcctggcaaagaacccaag
gaaggcgagcggaagatttacttggcaattgaaagtgccaatgaactggctgtgcagaaa
gcaaaggcagaaatcaccaggctcataaaagaagagctgatccggctgcaaaattcatac
caaccaacaaataaaggaagatacaaagtcttatag

DBGET integrated database retrieval system