KEGG   Homo sapiens (human): 9935
Entry
9935              CDS       T01001                                 
Symbol
MAFB, DURS3, KRML, MCTO
Name
(RefSeq) MAF bZIP transcription factor B
  KO
K09036  transcription factor MAFB
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Disease
H00633  Duane retraction syndrome
H01865  Multicentric carpotarsal osteolysis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    9935 (MAFB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9935 (MAFB)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    9935 (MAFB)
SSDB
Motif
Pfam: bZIP_Maf Maf_N KASH_CCD bZIP_1 HOOK DUF4164 bZIP_2 Vta1 UPF0449 Uso1_p115_C CC149 MbeD_MobD JIP_LZII
Other DBs
NCBI-GeneID: 9935
NCBI-ProteinID: NP_005452
OMIM: 608968
HGNC: 6408
Ensembl: ENSG00000204103
Vega: OTTHUMG00000033052
Pharos: Q9Y5Q3(Tbio)
UniProt: Q9Y5Q3
LinkDB
Position
20:complement(40685848..40689236)
AA seq 323 aa
MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPL
STPCSSVPSSPSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQP
LQSFDSFRGAHHHHHHHHPHPHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPA
QQLPTSHPGPGPHATASATAAGGNGSVEDRFSDDQLVSMSVRELNRHLRGFTKDEVIRLK
QKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKCEK
LANSGFREAGSTSDSPSSPEFFL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggccgcggagctgagcatggggccagagctgcccaccagcccgctggccatggagtat
gtcaacgacttcgacctgctcaagttcgacgtgaagaaggagccactggggcgcgcggag
cgtccgggcaggccctgcacacgcctgcagccagccggctcggtgtcctccacaccgctc
agcactccgtgtagctccgtgccctcgtcgcccagcttcagcccgaccgaacagaagaca
cacctcgaggatctgtactggatggcgagcaactaccagcagatgaaccccgaggcgctc
aacctgacgcccgaggacgcggtggaagcgctcatcggctcgcacccagtgccacagccg
ctgcaaagcttcgacagctttcgcggcgctcaccaccaccaccatcaccaccaccctcac
ccgcaccacgcgtacccgggcgccggcgtggcccacgacgagctgggcccgcacgctcac
ccgcaccatcaccatcatcaccaagcgtcgccgccgccgtccagcgccgctagcccggcg
caacagctgcccactagccaccccgggcccgggccgcacgcgacggcctcggcgacggcg
gcgggcggcaacggcagcgtggaggaccgcttctccgacgaccagctcgtgtccatgtcc
gtgcgcgagctgaaccgccacctgcggggcttcaccaaggacgaggtgatccgcctgaag
cagaagcggcggaccctgaagaaccggggctacgcccagtcttgcaggtataaacgcgtc
cagcagaagcaccacctggagaatgagaagacgcagctcattcagcaggtggagcagctt
aagcaggaggtgtcccggctggcccgcgagagagacgcctacaaggtcaagtgcgagaaa
ctcgccaactccggcttcagggaggcgggctccaccagcgacagcccctcctctcccgag
ttctttctgtga

DBGET integrated database retrieval system