Hibiscus syriacus (Rose-of-Sharon): 120149883 Help Entry 120149883         CDS       T09559                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03420   Nucleotide excision repair hsyr04120   Ubiquitin mediated proteolysis hsyr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120149883    04120 Ubiquitin mediated proteolysis     120149883   09124 Replication and repair    03420 Nucleotide excision repair     120149883  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hsyr04121]     120149883    03400 DNA repair and recombination proteins [BR:hsyr03400]     120149883 Enzymes [BR:hsyr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120149883 Ubiquitin system [BR:hsyr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120149883   Multi subunit type E3    SCF complex     Ring finger protein      120149883    Cul2 complex      120149883    Cul3 complex      120149883    Cul4 complex      120149883    Cul7 complex      120149883    Cul8 complex      120149883    Cul9 complex      120149883 DNA repair and recombination proteins [BR:hsyr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120149883     TCR (transcription coupled repair) factors      Cul4-CSA complex       120149883 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  120149883 NCBI-ProteinID:  XP_039018516 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MATLDYDVPMVPVGESSNRSAASSSTKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctactctagactatgatgttcccatggtccccgtcggagaatcttcaaacagatcc gccgcttcctcctccactaaaaagcccaagcgcttcgagatcaaaaagtggagcgccgtt gcactctgggcttgggatattgttgtggataattgtgcgatttgcaggaatcacatcatg gatctctgtatcgaatgccaagcaaaccaagccagcgccaccagcgaggaatgcactgtc gcttggggggtctgcaaccatgcatttcacttccactgtatcagccgatggttgaagact cgtcaagtgtgcccattggataatagtgagtgggagttccagaagtatggtcactaa

DBGET integrated database retrieval system