Hibiscus syriacus (Rose-of-Sharon): 120156633 Help Entry 120156633         CDS       T09559                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03420   Nucleotide excision repair hsyr04120   Ubiquitin mediated proteolysis hsyr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120156633    04120 Ubiquitin mediated proteolysis     120156633   09124 Replication and repair    03420 Nucleotide excision repair     120156633  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hsyr04121]     120156633    03400 DNA repair and recombination proteins [BR:hsyr03400]     120156633 Enzymes [BR:hsyr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120156633 Ubiquitin system [BR:hsyr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120156633   Multi subunit type E3    SCF complex     Ring finger protein      120156633    Cul2 complex      120156633    Cul3 complex      120156633    Cul4 complex      120156633    Cul7 complex      120156633    Cul8 complex      120156633    Cul9 complex      120156633 DNA repair and recombination proteins [BR:hsyr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120156633     TCR (transcription coupled repair) factors      Cul4-CSA complex       120156633 SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  120156633 NCBI-ProteinID:  XP_039023861 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MATLDSDVPMIPAGEASSSTAPSSSSKKPKRLEIKKWSAVGFGLGILSWIIVKFAGITSW TFLTKPAPPARNALLLGGSATMHSTFTVSADV NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggctactctagattccgatgtcccgatgattcccgccggtgaggcttcaagcagcacc gccccttcctcctcatctaagaagcccaagcggcttgagatcaaaaagtggagtgctgtt ggctttgggcttgggatattgtcgtggataattgtgaaatttgcaggaatcacatcatgg acctttctaaccaagccagcgccaccagcgaggaatgcactgttgcttggggggtctgca accatgcattccactttcactgtatcagccgatgtctga

DBGET integrated database retrieval system