Hibiscus syriacus (Rose-of-Sharon): 120179762 Help Entry 120179762         CDS       T09559                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03420   Nucleotide excision repair hsyr04120   Ubiquitin mediated proteolysis hsyr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120179762    04120 Ubiquitin mediated proteolysis     120179762   09124 Replication and repair    03420 Nucleotide excision repair     120179762  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hsyr04121]     120179762    03400 DNA repair and recombination proteins [BR:hsyr03400]     120179762 Enzymes [BR:hsyr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120179762 Ubiquitin system [BR:hsyr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120179762   Multi subunit type E3    SCF complex     Ring finger protein      120179762    Cul2 complex      120179762    Cul3 complex      120179762    Cul4 complex      120179762    Cul7 complex      120179762    Cul8 complex      120179762    Cul9 complex      120179762 DNA repair and recombination proteins [BR:hsyr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120179762     TCR (transcription coupled repair) factors      Cul4-CSA complex       120179762 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 Motif Other DBs NCBI-GeneID:  120179762 NCBI-ProteinID:  XP_039041199 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MATLDSDVPMVPVGEASSSTSPSTSTKKLKRFEIKKWSAVAHWAWGIECQANQASSTREE CTVAWGVCNHAFHFHSISRWLKTRQVCTLGMLCLHVYAGRIFCPVPFF NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctactctagattccgacgtcccgatggttcccgtcggcgaggcttcaagcagcact tctccttccacctccactaagaagctcaagcgcttcgagatcaaaaagtggagtgcggtt gctcactgggcttggggcattgaatgccaagccaaccaagcaagttccaccagggaggaa tgcactgttgcgtggggtgtctgcaaccatgcattccactttcactccatcagccgatgg ttgaagacccgtcaagtgtgtactttgggtatgctttgtctccatgtttatgctggtcgg atattttgccccgttccattcttttga

DBGET integrated database retrieval system