Hibiscus syriacus (Rose-of-Sharon): 120180049 Help Entry 120180049         CDS       T09559                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr00510   N-Glycan biosynthesis hsyr00513   Various types of N-glycan biosynthesis hsyr04141   Protein processing in endoplasmic reticulum Module hsyr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:hsyr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     120180049    00513 Various types of N-glycan biosynthesis     120180049  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120180049 SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Claudin_3 Motif Other DBs NCBI-GeneID:  120180049 NCBI-ProteinID:  XP_039041410 LinkDB All DBs Position Unknown AA seq 85 aa AA seqDB search MASAKAITSPVPDARYPTLAVLMLAVGLVLTASFFIYEATSSKRNRSLAKELTVGGVASV FLGFGSLFLLLSAGVCLIVVLLKPL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcttctgcaaaagcaataacgagtccagtgccagatgcgaggtacccaaccctagcc gtcttgatgctcgccgttggtcttgtcctcaccgcttctttcttcatctatgaagcaact tcttcaaagcgaaatcgcagccttgccaaggagctcaccgtcgggggagtggcatcggtg ttcttgggctttggatcattgtttttgctactttcagctggtgtatgcctgattgttgta ttgctcaaaccattataa

DBGET integrated database retrieval system