Hibiscus syriacus (Rose-of-Sharon): 120193390 Help Entry 120193390         CDS       T09559                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03420   Nucleotide excision repair hsyr04120   Ubiquitin mediated proteolysis hsyr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120193390    04120 Ubiquitin mediated proteolysis     120193390   09124 Replication and repair    03420 Nucleotide excision repair     120193390  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hsyr04121]     120193390    03400 DNA repair and recombination proteins [BR:hsyr03400]     120193390 Enzymes [BR:hsyr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120193390 Ubiquitin system [BR:hsyr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120193390   Multi subunit type E3    SCF complex     Ring finger protein      120193390    Cul2 complex      120193390    Cul3 complex      120193390    Cul4 complex      120193390    Cul7 complex      120193390    Cul8 complex      120193390    Cul9 complex      120193390 DNA repair and recombination proteins [BR:hsyr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120193390     TCR (transcription coupled repair) factors      Cul4-CSA complex       120193390 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  120193390 NCBI-ProteinID:  XP_039051852 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MAALDSDFPMVPAGEASSATAPSSSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggccgctctagattccgatttcccgatggttcccgccggtgaggcttcaagcgccacc gctccttcctcctcatctaagaagcccaagcgattcgagatcaaaaagtggagtgctgtt gctctttgggcttgggatattgtggtggataattgtgcaatttgcaggaatcacattatg gacctctgtatcgaatgccaagctaaccaagccagcgccaccagcgaggaatgcactgtt gcttggggggtctgcaaccatgcattccactttcactgtatcagccgctggttgaagact cgtcaagtatgcccgttggataatagtgaatgggagttccaaaagtatggccactag

DBGET integrated database retrieval system