Hibiscus syriacus (Rose-of-Sharon): 120211863 Help Entry 120211863         CDS       T09559                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03420   Nucleotide excision repair hsyr04120   Ubiquitin mediated proteolysis hsyr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120211863    04120 Ubiquitin mediated proteolysis     120211863   09124 Replication and repair    03420 Nucleotide excision repair     120211863  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:hsyr04121]     120211863    03400 DNA repair and recombination proteins [BR:hsyr03400]     120211863 Enzymes [BR:hsyr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      120211863 Ubiquitin system [BR:hsyr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    120211863   Multi subunit type E3    SCF complex     Ring finger protein      120211863    Cul2 complex      120211863    Cul3 complex      120211863    Cul4 complex      120211863    Cul7 complex      120211863    Cul8 complex      120211863    Cul9 complex      120211863 DNA repair and recombination proteins [BR:hsyr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       120211863     TCR (transcription coupled repair) factors      Cul4-CSA complex       120211863 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  120211863 NCBI-ProteinID:  XP_039066260 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MAALDSDVPMVPVGESSNSSAASSSTKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctgctctagattctgatgttcccatggtccccgtcggagaatcttcaaacagctcc gccgcttcctcctccactaagaagcccaagcgttttgagatcaaaaagtggagcgccgtt gccctctgggcttgggatattgttgtggataattgtgcgatttgcaggaatcacatcatg gatctatgtattgaatgccaagcaaaccaagccagcgccaccagtgaggaatgcactgtt gcttggggggtctgtaaccatgcatttcacttccactgtatcagccgatggctgaagact cgtcaagtgtgtccattggataatagtgagtgggaattccaaaagtatggtcactaa

DBGET integrated database retrieval system