Hibiscus syriacus (Rose-of-Sharon): 120218689 Help Entry 120218689         CDS       T09559                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr00510   N-Glycan biosynthesis hsyr00513   Various types of N-glycan biosynthesis hsyr04141   Protein processing in endoplasmic reticulum Module hsyr_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:hsyr00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     120218689    00513 Various types of N-glycan biosynthesis     120218689  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120218689 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  120218689 NCBI-ProteinID:  XP_039071522 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search MAPPVKPITSPVPDAWYPTLAVFMLVIGLVLAASFFIYEATSSKRNRCLAKELTTGGVAS VFLGFGSLFLLLSAGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctcctcctgtaaagccaataacgagcccggtgcctgatgcatggtacccaacccta gccgtcttcatgcttgtcattggtcttgtcctcgccgcttccttcttcatctacgaagca acttcttctaaacgaaatcgctgccttgcaaaggagctcaccacagggggagtggcatct gtcttcctgggatttgggtcattgtttttgttactttcagcaggtgtttatgtatga

DBGET integrated database retrieval system