KEGG   Haloarcula taiwanensis: BVU17_12045
Entry
BVU17_12045       CDS       T05292                                 

Name
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
hta  Haloarcula taiwanensis
Pathway
hta00630  Glyoxylate and dicarboxylate metabolism
hta01100  Metabolic pathways
hta01120  Microbial metabolism in diverse environments
hta01200  Carbon metabolism
Module
hta_M00740  Methylaspartate cycle
Brite
KEGG Orthology (KO) [BR:hta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BVU17_12045
Enzymes [BR:hta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     BVU17_12045
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     BVU17_12045
SSDB
Motif
Pfam: HpcH_HpaI
Other DBs
NCBI-ProteinID: AUG48219
UniProt: A0A2H5A0F8
LinkDB
Position
I:2377887..2379194
AA seq 435 aa
MSVTRHYEREFVRTFFTSPTAVDGESDSAKMLRSAGQLRGLQAPDVWVPDNEDATAPNMR
EEGVQNIIDVVSEQGADFPGEIHPRVVWHRESPTTRYQGFQQMLEITDPENGAVEHIDGF
VIPEVGDIDDWKKADEFFTIIENEHGLEEGSLSMSVIVESGEAELAMGDLRDEMGKPSNN
LERMFLLVDGEVDYTKDMRAMTPTGELPPWPELRHNTSRGASAAGLIAVDGPYDDIRDVE
GYRERMKDNRAKGMTGIWSLTPGQVVEANTAPLPPKTGSWLLEAGGQEVELEHEDGRQVY
DGDDLSLEPDGDGGYVLRAGGERLELDEDELTEELLDRTAYIPSMNDIVDSMEEFEAAKE
AGKGAIAMTQAATLVIDGVEVEVSKDRMWDEATYQAAQTPITLFQDVYEHRPDQHEELEE
MYGADVVERATAVGN
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgagtgtgacccgacactacgagcgcgagttcgtcagaacgttctttacctcgccgaca
gcggtggacggcgagagcgattcagccaagatgctccgaagcgcgggccagctccgtggc
ctgcaggccccggacgtctgggtcccggacaacgaggacgcgacggccccgaacatgcgc
gaggagggcgtccagaacatcatcgacgtggtctccgaacagggagccgacttccccggc
gagatacacccgcgtgtcgtctggcaccgcgagtcgccgacgacccgctatcagggcttc
cagcagatgctggagataacagaccccgaaaacggtgccgtcgagcacatcgacggcttc
gtcattccggaggtcggcgatatcgacgactggaagaaggccgacgagttcttcaccatc
atcgagaacgagcacgggctcgaagaggggagtctctcgatgtcggtcatcgtcgagagc
ggcgaggccgagttggcgatgggcgacctacgggacgagatgggcaagccctcgaacaac
ctcgaacgcatgttcctgctggtcgacggcgaggtcgactacacgaaggacatgcgcgcg
atgacgcccaccggcgaactgccgccgtggccggaactgcgccacaacacctcccggggt
gccagtgccgcgggcctcatcgccgtcgacggtccctatgacgacatccgcgacgtcgaa
ggctaccgcgagcgaatgaaggacaaccgcgcgaaggggatgaccggcatctggtcgctg
acgccgggtcaagtcgtggaggcgaacacggccccgctcccgcccaagaccggcagctgg
ctgctcgaagccggcggtcaggaggtcgaactcgaacatgaggacggcaggcaggtgtac
gacggcgacgacctctcgctggagccggacggcgacggcggctacgtccttcgggcaggc
ggtgagcggctggaactggacgaggatgaactcaccgaggaactgctcgaccggaccgca
tacatccccagcatgaacgacatcgtcgactctatggaggagttcgaggccgcaaaggaa
gccggcaagggggccatcgcgatgacacaggccgcgacactggtcatcgacggcgtcgaa
gtcgaggtcagcaaggaccggatgtgggacgaagcgacctatcaggccgcccagacgccc
atcacgctgtttcaagatgtctacgagcaccggccggaccaacacgaagaactagaggag
atgtacggagccgacgtggtcgagcgggcgaccgccgtcgggaactga

DBGET integrated database retrieval system