KEGG   Hypericibacter terrae: FRZ44_11160
Entry
FRZ44_11160       CDS       T06396                                 
Symbol
ligA
Name
(GenBank) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
htq  Hypericibacter terrae
Pathway
htq03030  DNA replication
htq03410  Base excision repair
htq03420  Nucleotide excision repair
htq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:htq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    FRZ44_11160 (ligA)
   03410 Base excision repair
    FRZ44_11160 (ligA)
   03420 Nucleotide excision repair
    FRZ44_11160 (ligA)
   03430 Mismatch repair
    FRZ44_11160 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:htq03032]
    FRZ44_11160 (ligA)
   03400 DNA repair and recombination proteins [BR:htq03400]
    FRZ44_11160 (ligA)
Enzymes [BR:htq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     FRZ44_11160 (ligA)
DNA replication proteins [BR:htq03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     FRZ44_11160 (ligA)
DNA repair and recombination proteins [BR:htq03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     FRZ44_11160 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     FRZ44_11160 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     FRZ44_11160 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FRZ44_11160 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT DNA_ligase_ZBD HHH_5 PTCB-BRCT Nlig-Ia HHH RNA_ligase
Other DBs
NCBI-ProteinID: QEX15829
UniProt: A0A5J6MEN7
LinkDB
Position
complement(1198930..1201101)
AA seq 723 aa
MTKKPAATIAALRVDELTEAQAEKELARLAAEIAHHDKLYHQKDAPEISDAAYDALVNRN
KAIEARFPGLKRLDSPSARVGAAPASGFAKVTHSRPMLSLDNGFSTEDVTDFLGRIRRFL
KLPDDSDIEMVAEPKIDGLSAALTYENGRFVQGATRGDGSVGEDITRNLATIADLPKQLH
GRHQGKLIEVRGEVYMRHADFRQLNKTREADGEAVFANPRNAAAGSVRQLDPAITASRPL
RFFAYAEGETSGAIDDCKTHWDFLERLKEWGFTVNPLVKRCEDEKALLAFYEKIGAQRAK
LDYDIDGVVYKVDRRDWQQRLGFVGRAPRWALAHKFPAERAETRLNAITIQVGRTGALTP
VAELEPITVGGVVVSRATLHNEDEIERKDIREGDWVVVQRAGDVIPQIVEVIKKRRPRDS
KAYKFPTKCPVCHSLAIREIDEAVRRCTGGLICPAQAVERLRHFVSRGAADIEGLGEKHI
QAFWDEGWLKTPGDIYRLTNHRDELVAREGWGEQSVKKLLDAIEARRRLPLDRFIYALGI
RQVGEQTAKLLARHYETLAAWRDAMIEASQGLKQAMKQSTEDLPLDVWRLAGSLSPAIGD
LDAIEGIGPSVANDIVDFFAEPHNREVLKDLEREIEVPPFKAPKIGNSPVAGKTVVFTGT
LETMGRNEAKAKAESLGAKVAGSVSSKTDYVIVGADAGSKAKKAAELGVKTLSEQDWIKL
IGG
NT seq 2172 nt   +upstreamnt  +downstreamnt
atgacgaagaaacccgccgcgacgatcgcggccctccgcgtcgacgagctgaccgaggcg
caggccgagaaggagctggcgcggttggcggccgagatcgcccatcacgacaagctctac
catcagaaggacgcgcccgagatctcggacgccgcctatgacgcgctcgtcaaccgcaac
aaggcgatcgaagcgcgctttcccggcctcaaacgcctcgacagcccttccgcgcgcgtc
ggcgcggcgccggccagcggattcgccaaggtcacgcacagccggccgatgctctcgctc
gacaacggcttcagcacggaagacgtcaccgatttcctcggccgcatccgccgcttcctc
aagctgccggacgacagcgatatcgagatggtggccgagcccaagatcgacgggctttcc
gcggccctcacctacgagaacggccgtttcgtccagggcgccacgcgcggcgacggcagc
gtgggcgaggacatcacccgcaacctcgccaccatcgccgatctgcccaagcagcttcac
ggccgccatcagggcaagctcatcgaggtgcgcggcgaagtctatatgcgccacgccgat
ttccggcagctcaacaagacgcgcgaggccgacggcgaagcggtcttcgccaatccgcgc
aacgccgccgccggcagcgtgcgccagctcgatcccgccatcaccgcgagccgccccttg
cgcttcttcgcctatgccgagggggagaccagcggcgccatcgacgattgcaagacccac
tgggatttcctcgagcgcctcaaggaatggggcttcaccgtcaatccgctggtcaagcgc
tgcgaggacgagaaggcgctgctggccttctacgagaagatcggcgcgcagcgcgccaag
ctcgattacgacatcgacggcgtcgtctacaaggtggaccgccgcgactggcagcagcgg
ctgggcttcgtcggccgcgccccgcgctgggcgctggcgcacaagttccccgccgagcgg
gcggagacgcggctcaacgccatcaccatccaggtcggccgcaccggcgcgctgacaccg
gtggccgagctcgagccgatcacggtcggcggcgtggtggtgtcgcgcgcgaccttgcat
aacgaggacgagatcgagcgcaaggatatccgcgaaggcgactgggtcgtggtgcagcgc
gccggcgacgtgatcccgcagatcgtcgaggtgatcaagaagcgccgcccgcgcgattcc
aaagcctataagtttcccaccaagtgccccgtctgccacagcctcgcgatccgcgaaatc
gacgaggcggtgcggcgctgcaccggcgggctgatctgcccggcccaggcggtcgagcgg
ctgcgccatttcgtgagccgcggggctgccgatatcgaggggctcggcgagaagcatatc
caggccttctgggacgaaggctggctcaagacgccgggcgacatctatcgcctgacgaat
caccgcgacgagctggtcgcgcgcgaaggctggggcgagcagtcggtcaagaagctcctg
gatgcgatcgaggcgcgccgccggttgccgctcgaccgcttcatctatgcgctcggcatc
cgccaggtgggcgagcagaccgccaagctgctggcgcgccactacgagacgctggccgcc
tggcgcgacgcgatgatcgaggcgagccagggcctgaaacaggcgatgaagcaatcgacc
gaggatctgcctctcgatgtctggcgcctcgccggcagcctcagccccgccatcggcgat
ctcgacgcgatcgaaggcatcggcccttcagtcgccaacgacatcgtcgatttcttcgcc
gaaccgcataaccgcgaggtgctgaaggatctggagcgggagatcgaggtcccgcccttc
aaggcacccaagatcggcaactcgcccgtcgccggcaagaccgtggtcttcaccggcacg
ctcgagaccatgggccgcaacgaggccaaggccaaggccgaatccctcggcgccaaggtc
gcgggctcggtctccagcaagaccgactatgtgatcgtcggcgccgacgccggctccaag
gccaagaaggccgccgagctcggcgtgaagacgctgagcgagcaggactggatcaagctc
atcggcgggtga

DBGET integrated database retrieval system