KEGG   Halopiger xanaduensis: Halxa_4145
Entry
Halxa_4145        CDS       T01532                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
hxa  Halopiger xanaduensis
Pathway
hxa00053  Ascorbate and aldarate metabolism
hxa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hxa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Halxa_4145
Enzymes [BR:hxa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     Halxa_4145
SSDB
Motif
Pfam: Epimerase RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 3Beta_HSD NAD_binding_10 DapB_N GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: AEH38749
UniProt: F8D4Y8
LinkDB
Position
3498827..3499633
AA seq 268 aa
MTNIAITGASGTVGREAIAAFDGTDAELTLFSHSETEDLETTPVDIADHDAFVDALDDQD
VLIHLAANADPRAEWEAVRGPNIDGLYNAYEAALENDLERVVFASSNHAVNMGNAVSSVR
PESTIGEPEVVRPDDATDPDTYYGVTKVFGEAMGSYYAKRHGLDVVTLRIGWLLTREELR
QTVAERDGPGERYARAMWLSPEDCRRVLRAAATSTLSRTPLTAHGISNNGKRFLSLSETM
LALDYRPRDDAEAVLSDDESEREGLETG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgacgaacatcgcgatcaccggcgcgtccggcaccgtcggcagggaagcgatcgcggcc
ttcgacggcaccgacgccgagctgacgctcttttcgcacagcgagacggaggacctcgag
acgacgcccgtcgatatcgccgaccacgatgcgttcgtcgacgcgctcgacgaccaggac
gtgctgatccacctcgcggccaacgccgatccgcgggcggagtgggaggccgttcggggg
ccgaatatcgacggcctctacaacgcctacgaggccgcgctcgagaacgacctcgagcgg
gtcgtcttcgcgagttcgaaccacgcggtcaacatgggcaacgccgtctcgagcgtccgc
ccggagtcgacgatcggcgagcccgaggtggtgcgacccgacgacgcgacggatccggac
acctactacggcgtcacgaaggtcttcggcgaggcgatgggatcctactacgcgaaacgg
cacgggctggacgtggtcaccctccgcatcggctggctgctcacacgtgaggagctccgc
cagacggtcgcggagcgggacgggcccggcgagcgctacgcccgcgcgatgtggcttagc
cccgaggactgtcggcgggtacttcgggcggccgcaaccagtaccctgtcgcggacgccg
ctgaccgcccacggcatctcgaacaacgggaagcgatttctctcgctgtcggagacgatg
ctcgcgctggattaccggccgcgggacgacgccgaagcggtgctgtccgacgacgagtcc
gagcgtgagggtctcgagacggggtga

DBGET integrated database retrieval system