Idiomarina sp. X4: CWC33_08685 Help Entry CWC33_08685       CDS       T05226                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism idi  Idiomarina sp. X4 Pathway idi00790   Folate biosynthesis idi01100   Metabolic pathways idi01240   Biosynthesis of cofactors Module idi_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:idi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CWC33_08685 (folB) Enzymes [BR:idi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CWC33_08685 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CWC33_08685 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CWC33_08685 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB FOG_N DUF7348 Motif Other DBs NCBI-ProteinID:  ATZ73769 LinkDB All DBs Position 1820623..1821006 Genome browser AA seq 127 aa AA seqDB search MEQADIDVVSIEGLSVDTIIGVYDWEKEKKQTLTLDIQMSWDNQTAAKSDDLNDALDYAL VSEKVTQWVAEKPRQLIETVAEGVASLILNEFGVQNVEVKVSKPGAVPNAANVAVTVRRS VFDSPFG NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggaacaagcggatatcgatgtggttagcattgaaggcctcagcgtcgacacaattata ggcgtgtacgactgggagaaagagaagaagcaaacactcactttagatattcaaatgagc tgggataaccaaacagccgcgaagtccgatgacttgaacgacgctctggattacgcctta gtcagtgaaaaagtgactcaatgggttgccgaaaaaccgcgtcagttaatagaaactgta gccgagggggttgccagcttaattcttaatgaatttggtgtacagaatgttgaagtaaaa gtgtcgaagcctggtgccgttccgaacgctgcgaatgttgcagtgacggttcgtcgcagt gttttcgacagtccgttcggataa

DBGET integrated database retrieval system