Ictalurus furcatus (blue catfish): 128609779 Help Entry 128609779         CDS       T09387                                  Symbol bcl2b Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04115   p53 signaling pathway ifu04140   Autophagy - animal ifu04141   Protein processing in endoplasmic reticulum ifu04210   Apoptosis ifu04217   Necroptosis ifu04261   Adrenergic signaling in cardiomyocytes ifu04340   Hedgehog signaling pathway ifu04510   Focal adhesion ifu04621   NOD-like receptor signaling pathway ifu05132   Salmonella infection ifu05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ifu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     128609779 (bcl2b)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     128609779 (bcl2b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128609779 (bcl2b)   09143 Cell growth and death    04210 Apoptosis     128609779 (bcl2b)    04217 Necroptosis     128609779 (bcl2b)    04115 p53 signaling pathway     128609779 (bcl2b)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128609779 (bcl2b)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     128609779 (bcl2b)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     128609779 (bcl2b)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     128609779 (bcl2b)   09171 Infectious disease: bacterial    05132 Salmonella infection     128609779 (bcl2b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ifu01009]     128609779 (bcl2b) Protein phosphatases and associated proteins [BR:ifu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      128609779 (bcl2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 SQHop_cyclase_C Motif Other DBs NCBI-GeneID:  128609779 NCBI-ProteinID:  XP_053484517 LinkDB All DBs Position 7:complement(12719142..12750107) Genome browser AA seq 204 aa AA seqDB search MANGNLYDNRRIVEKYLNHKLSKNGHAREFHRCRASSLDGQEEREKESARRVTLHMALRE AGDELESLYRPELAEMVKGLRATSVGTEQPRFVAVADELFRDGVNWGRVVAFFEYGAMVC VQCAPDAERNACAENVARWMAEYLNGPLNDWIQENGGWDAFVELYTRKKDSVYSSSWPSL TTSVFSLAALGAVGLTIGAYLTQK NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcgaacggaaatctgtacgataaccggcgcatcgtggaaaagtatctgaaccacaaa ctgtcgaaaaacggccacgcgcgggagtttcatcggtgccgcgcgagcagcctggacggc caggaggagcgcgagaaggagagcgcgcgccgcgtaactctgcacatggctttgcgcgag gccggtgacgaactggaaagcttgtaccgaccggagttggcggagatggtgaagggcctg cgcgcgacatcggtgggcacggagcagccgcggttcgtggccgtggcggacgagctgttc cgcgatggagtgaactggggtcgcgtggtggcatttttcgagtacggcgcgatggtgtgc gtgcagtgcgctccggacgccgagaggaacgcgtgtgccgagaacgtcgcgcgctggatg gccgagtacctgaacggcccgctgaacgactggatccaggagaacggaggatgggatgcc tttgtggagctgtacacgaggaaaaaggattcggtgtacagcagctcctggccgtcctta acgacgtccgtcttcagtttggcggcactgggggcagtcggtctcaccattggggcttat ctgactcagaaatga

DBGET integrated database retrieval system