Ictalurus furcatus (blue catfish): 128618144 Help Entry 128618144         CDS       T09387                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu00510   N-Glycan biosynthesis ifu00513   Various types of N-glycan biosynthesis ifu04141   Protein processing in endoplasmic reticulum Module ifu_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ifu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     128618144 (tmem258)    00513 Various types of N-glycan biosynthesis     128618144 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     128618144 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  128618144 NCBI-ProteinID:  XP_053497573 LinkDB All DBs Position 14:5822275..5824691 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgaccagatacacgagtccggtgaacccggccgtgtttcctcac ctcaccgtggtgctgctcgccatcggcatgttcttcacagcgtggttctttgtctacgag gtaacgtccacgaaatacacacgagacatatacaaggagctgctcatctcactggtcgcg tcactcttcatgggcttcggcgttctcttcctgctgctttgggttggaatctacgtgtga

DBGET integrated database retrieval system