Ictalurus furcatus (blue catfish): 128623063 Help Entry 128623063         CDS       T09387                                  Symbol rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism ifu  Ictalurus furcatus (blue catfish) Pathway ifu04010   MAPK signaling pathway ifu04510   Focal adhesion ifu04517   IgSF CAM signaling ifu04520   Adherens junction Brite KEGG Orthology (KO) [BR:ifu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128623063 (rap1b)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     128623063 (rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     128623063 (rap1b)    04520 Adherens junction     128623063 (rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ifu04147]     128623063 (rap1b)    04031 GTP-binding proteins [BR:ifu04031]     128623063 (rap1b) Exosome [BR:ifu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128623063 (rap1b)   Exosomal proteins of other body fluids (saliva and urine)    128623063 (rap1b)   Exosomal proteins of colorectal cancer cells    128623063 (rap1b) GTP-binding proteins [BR:ifu04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     128623063 (rap1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  128623063 NCBI-ProteinID:  XP_053505900 LinkDB All DBs Position 19:complement(16113789..16165696) Genome browser AA seq 185 aa AA seqDB search MMREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTA GTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCD LEDERVVGKEQGQNLARQWNSCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKS NCQLL NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgatgcgtgaatacaagttagtagtcctcggctctggaggtgtcggcaagtctgcactg actgttcagtttgttcaggggatctttgtggagaagtatgaccccacaatagaagactcg tatagaaagcaagtagaggtggatggccagcagtgtatgttggagatcctggacactgca ggaacggaacaattcacagccatgagggacctttacatgaagaacggccagggcttcgca ctagtatactccataactgcacagtccacgttcaatgacctgcaggacttgagagaacag atcctgcgagttaaagacaccgatgatgtgccgatgatcctggtggggaataagtgtgat ctggaggatgagagagtggtgggaaaggagcagggacagaacctggcccgccagtggaac agctgtgccttcctcgagtcctccgcaaagtccaagattaacgtcaatgagatcttctat gacctggtccggcaaatcaacaggaaaaccccggtacctgggaaggcacgcaaaaagtcc aactgtcagctgctctaa

DBGET integrated database retrieval system