Ictalurus furcatus (blue catfish): 128623397
Help
Entry
128623397 CDS
T09387
Symbol
ifng1
Name
(RefSeq) interferon gamma 1 isoform X1
KO
K04687
interferon gamma
Organism
ifu
Ictalurus furcatus (blue catfish)
Pathway
ifu03050
Proteasome
ifu04060
Cytokine-cytokine receptor interaction
ifu04217
Necroptosis
ifu04350
TGF-beta signaling pathway
ifu05168
Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:
ifu00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
128623397 (ifng1)
09130 Environmental Information Processing
09132 Signal transduction
04350 TGF-beta signaling pathway
128623397 (ifng1)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
128623397 (ifng1)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
128623397 (ifng1)
09160 Human Diseases
09172 Infectious disease: viral
05168 Herpes simplex virus 1 infection
128623397 (ifng1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:
ifu03051
]
128623397 (ifng1)
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
ifu04052
]
128623397 (ifng1)
00536 Glycosaminoglycan binding proteins [BR:
ifu00536
]
128623397 (ifng1)
Proteasome [BR:
ifu03051
]
Eukaryotic proteasome
Assembling factors
Other assembling factors
128623397 (ifng1)
Cytokines and neuropeptides [BR:
ifu04052
]
Cytokines
Interferons
128623397 (ifng1)
Glycosaminoglycan binding proteins [BR:
ifu00536
]
Heparan sulfate / Heparin
Cytokines
128623397 (ifng1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
IFN-gamma
Int_N
DUF7370
Myb_DNA-bind_4
Phage_int_SAM_4
DUF7342
Motif
Other DBs
NCBI-GeneID:
128623397
NCBI-ProteinID:
XP_053506414
LinkDB
All DBs
Position
19:16236046..16238509
Genome browser
AA seq
179 aa
AA seq
DB search
MMTLFWRICFVFFGMMAYSEASLPKNIKESIDHLNNHYVRKNPNPGKLYDGHSLFLDKLK
DRTFEEGEQKLLMTIILDAYNKIFTKMENETQDETLKNDLHEVKEQMNNLKEHYFSGKHA
EIKKYVTELLALKENDPRIQSKAIFELKAIYNKAANLGRMSAENPRRRRQAKSSKKQHS
NT seq
540 nt
NT seq
+upstream
nt +downstream
nt
atgatgactctgttttggagaatatgttttgtcttttttggaatgatggcgtactctgag
gcctccctcccgaagaacatcaaggagtctattgaccatctgaataatcattatgtaaga
aaaaatcccaaccctggcaaattgtacgatggtcattctctcttcctagacaagctgaag
gatagaacatttgaggagggtgaacagaagctcctgatgactattattctcgatgcatac
aacaaaattttcaccaagatggagaatgagactcaggatgaaacgctgaagaatgacttg
cacgaagtgaaagaacaaatgaacaatctgaaagaacactacttctccggcaaacatgca
gaaatcaagaaatatgtcactgagctgctggcccttaaggaaaatgacccacggatccag
agcaaagcaatatttgagctgaaggccatctacaataaggcagcgaacctggggaggatg
tcagcagaaaaccctcggagacgacgtcaagctaaaagctccaaaaagcagcattcataa
DBGET
integrated database retrieval system