Idiomarina loihiensis L2TR: IL0478 Help Entry IL0478            CDS       T00218                                  Symbol folA Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism ilo  Idiomarina loihiensis L2TR Pathway ilo00670   One carbon pool by folate ilo00790   Folate biosynthesis ilo01100   Metabolic pathways ilo01240   Biosynthesis of cofactors ilo04981   Folate transport and metabolism Module ilo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ilo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     IL0478 (folA)    00670 One carbon pool by folate     IL0478 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     IL0478 (folA) Enzymes [BR:ilo01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      IL0478 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Exonuc_VIII Motif Other DBs NCBI-ProteinID:  AAV81321 UniProt:  Q5R038 LinkDB All DBs Position 503435..503935 Genome browser AA seq 166 aa AA seqDB search MKISLVVAMADNRVIGKDNKMPWHLPDELQYFKKITLGKPIVMGRRTFESIGRPLPGRKN IVLSRRTDRSENQDSQVVWVSGVQQAIAAAGPVEELMIIGGGKIYEKFLPLADRLYVTKI ELNVEGDTYFPDYHQVADWQEIERQNFAADERNSHNFSTLIFDRVS NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaaaatatcactcgtggttgctatggccgataatcgggttattggaaaagataacaaa atgccatggcacctgccggacgagttgcaatatttcaaaaaaattaccttaggtaagcca attgttatggggcgccggacttttgagtcaattggtcgtcctttgcccggccgcaagaat atcgttctaagccgtcgaacggatcgttcggaaaatcaggacagtcaggtggtttgggtg tctggggtgcaacaggcaatagccgctgcaggtccggttgaggaactcatgattatcggc ggtggaaaaatttatgagaaatttttacccctcgcagaccgactatatgttactaaaata gaactaaatgttgagggtgatacttactttcccgattatcatcaagtcgccgactggcaa gagatagagcggcaaaactttgccgctgatgagcgcaactcccataactttagtactctt attttcgacagagtaagttaa

DBGET integrated database retrieval system