Ipomoea nil (Japanese morning glory): 109148084 Help Entry 109148084         CDS       T04663                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism ini  Ipomoea nil (Japanese morning glory) Pathway ini00510   N-Glycan biosynthesis ini00513   Various types of N-glycan biosynthesis ini04141   Protein processing in endoplasmic reticulum Module ini_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ini00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109148084    00513 Various types of N-glycan biosynthesis     109148084  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109148084 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6350 DUF6338 Motif Other DBs NCBI-GeneID:  109148084 NCBI-ProteinID:  XP_019151399 LinkDB All DBs Position Un AA seq 78 aa AA seqDB search MGQSAKPISGPVPESMYPTLAFFMLAVGLAVTASFFIYETTSSRKNRSLAKELTTAAVAS VFLGFGSLFLLLASGVFV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgggtcaatcagcgaaaccgatctccggcccggttccggaatcgatgtatccaacccta gccttcttcatgcttgccgttggcctcgccgtcactgcttccttcttcatctatgaaact acttcttctaggaagaaccgcagcctcgcaaaggagcttaccacagcggctgtggcatct gtattcttgggttttggatcgttgttcttactacttgcctcgggagtttttgtttga

DBGET integrated database retrieval system