Ipomoea nil (Japanese morning glory): 109186622 Help Entry 109186622         CDS       T04663                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ini  Ipomoea nil (Japanese morning glory) Pathway ini03420   Nucleotide excision repair ini04120   Ubiquitin mediated proteolysis ini04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ini00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109186622    04120 Ubiquitin mediated proteolysis     109186622   09124 Replication and repair    03420 Nucleotide excision repair     109186622  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ini04121]     109186622    03400 DNA repair and recombination proteins [BR:ini03400]     109186622 Enzymes [BR:ini01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109186622 Ubiquitin system [BR:ini04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109186622   Multi subunit type E3    SCF complex     Ring finger protein      109186622    Cul2 complex      109186622    Cul3 complex      109186622    Cul4 complex      109186622    Cul7 complex      109186622    Cul8 complex      109186622    Cul9 complex      109186622 DNA repair and recombination proteins [BR:ini03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109186622     TCR (transcription coupled repair) factors      Cul4-CSA complex       109186622 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  109186622 NCBI-ProteinID:  XP_019192232 LinkDB All DBs Position Un AA seq 125 aa AA seqDB search MASLDTDVTMVPAGEGEGGAGATSSVASTSSSAKKGKKFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcatccttggacaccgatgtgactatggttccggccggcgagggcgagggcggcgcc ggagcgacgtcttccgtggcgtcgacttcctcttcggccaagaaagggaagaaattcgag atcaaaaagtggaacgccgttgctctttgggcctgggatattgtggtggataattgtgca atttgtaggaaccacattatggatctctgtattgagtgtcaagctaatcaagctagtgca acaagtgaggaatgcacggttgcttggggagtttgcaaccatgcatttcatttccactgc atcagccgatggctcaaaactcgtcaagtgtgccccttggacaatagcgagtgggagttc cagaagtatggtcactaa

DBGET integrated database retrieval system