Ictalurus punctatus (channel catfish): 100528155 Help Entry 100528155         CDS       T04658                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu03008   Ribosome biogenesis in eukaryotes ipu03013   Nucleocytoplasmic transport ipu03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:ipu00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     100528155 (ran)    03008 Ribosome biogenesis in eukaryotes     100528155 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     100528155 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ipu03019]     100528155 (ran)    03009 Ribosome biogenesis [BR:ipu03009]     100528155 (ran)    03016 Transfer RNA biogenesis [BR:ipu03016]     100528155 (ran)    03036 Chromosome and associated proteins [BR:ipu03036]     100528155 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ipu04147]     100528155 (ran)    04031 GTP-binding proteins [BR:ipu04031]     100528155 (ran) Messenger RNA biogenesis [BR:ipu03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      100528155 (ran) Ribosome biogenesis [BR:ipu03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     100528155 (ran)   Pre-60S particles     100528155 (ran) Transfer RNA biogenesis [BR:ipu03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     100528155 (ran) Chromosome and associated proteins [BR:ipu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      100528155 (ran)    Spindle formation proteins     100528155 (ran) Exosome [BR:ipu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100528155 (ran) GTP-binding proteins [BR:ipu04031]  Small (monomeric) G-proteins   Ran Family    Ran     100528155 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU ArgoMid Motif Other DBs NCBI-GeneID:  100528155 NCBI-ProteinID:  NP_001187354 Ensembl:  ENSIPUG00000015737 UniProt:  E3TDZ9 LinkDB All DBs Position 8:complement(25125298..25128643) Genome browser AA seq 215 aa AA seqDB search MAENDPQVQFKLVLVGDGGTRKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKY NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMPA LAPPEIAMDPSLAAQYEHDLKVASETALPDEDDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcagagaacgacccacaagttcagtttaagctggtcctcgtaggagatggaggcacg aggaagactactttcgtgaagaggcacttgacaggagagtttgaaaagaaatatgttgcg actctgggtgtcgaagttcatcccttggtctttcacactaacagaggcgctatcaaatac aacgtgtgggacacagccggacaggagaagttcggaggcttgcgagacggatactatatc caagctcagtgtgcgatcatcatgttcgacgtaacctctcgagtgacttataagaatgtt cccaactggcatcgtgacctggtgcgtgtgtgcgagaacattcccatagtgctgtgcggc aacaaagtggacatcaaggacaggaaggtgaaagcgaagagcatcgtgttccaccgcaag aagaacctacagtactatgacatctccgccaagagtaattataacttcgagaagccgttc ttgtggcttgcgcgaaagctgattggagatcccaacttggagtttgtggagatgcctgcc ctcgccccacccgaaatcgctatggacccatcacttgctgcacagtacgagcatgaccta aaagtggcatcagaaacagctctgccagatgaggacgacgacctctaa

DBGET integrated database retrieval system