Ictalurus punctatus (channel catfish): 100528560 Help Entry 100528560         CDS       T04658                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu00510   N-Glycan biosynthesis ipu00513   Various types of N-glycan biosynthesis ipu04141   Protein processing in endoplasmic reticulum Module ipu_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ipu00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100528560 (tmem258)    00513 Various types of N-glycan biosynthesis     100528560 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100528560 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  100528560 NCBI-ProteinID:  NP_001187759 Ensembl:  ENSIPUG00000013660 UniProt:  E3TFJ8 LinkDB All DBs Position 14:4069091..4071581 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgaccagatacacgagtccggtgaacccggccgtgtttcctcac ctcaccgtggtgctgctcgccatcggcatgttcttcacagcgtggttctttgtctacgag gtaacgtccacgaaatacacacgagacatatacaaggagctgctcatctcactggtcgcg tcactcttcatgggcttcggcgttctcttcctgctgctttgggttggaatctacgtgtga

DBGET integrated database retrieval system