Ictalurus punctatus (channel catfish): 108256596 Help Entry 108256596         CDS       T04658                                  Symbol bcl2a Name (RefSeq) apoptosis regulator Bcl-2a   KO K02161   apoptosis regulator Bcl-2 Organism ipu  Ictalurus punctatus (channel catfish) Pathway ipu04115   p53 signaling pathway ipu04140   Autophagy - animal ipu04141   Protein processing in endoplasmic reticulum ipu04210   Apoptosis ipu04217   Necroptosis ipu04261   Adrenergic signaling in cardiomyocytes ipu04340   Hedgehog signaling pathway ipu04510   Focal adhesion ipu04621   NOD-like receptor signaling pathway ipu05132   Salmonella infection ipu05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ipu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108256596 (bcl2a)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     108256596 (bcl2a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108256596 (bcl2a)   09143 Cell growth and death    04210 Apoptosis     108256596 (bcl2a)    04217 Necroptosis     108256596 (bcl2a)    04115 p53 signaling pathway     108256596 (bcl2a)   09144 Cellular community - eukaryotes    04510 Focal adhesion     108256596 (bcl2a)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108256596 (bcl2a)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     108256596 (bcl2a)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     108256596 (bcl2a)   09171 Infectious disease: bacterial    05132 Salmonella infection     108256596 (bcl2a)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ipu01009]     108256596 (bcl2a) Protein phosphatases and associated proteins [BR:ipu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      108256596 (bcl2a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Cellsynth_D Motif Other DBs NCBI-GeneID:  108256596 NCBI-ProteinID:  XP_017309129 Ensembl:  ENSIPUG00000004823 UniProt:  A0A2D0PSX4 LinkDB All DBs Position 23:1452921..1513381 Genome browser AA seq 204 aa AA seqDB search MANQSPYDNRDIVEKYLYHKLLKRGYVWEFRAGAEEGDGLREPPAEVVDRRPRAVLPLHR VLREAGDEIERTYQRDFAAMSDQLHFTPSTAQRRFTAVIEELFRDGVNWGRIVVFFEFGS TLCVESVNQEMASQVDNIASWMTDYLNGPLQNWIRDNGGWDAFVELYSHQRASMFHPWPY LKTVFGLAALGAAGVTIGALFSQK NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcaaaccaaagtccctatgataatcgggatatcgttgagaagtatctgtatcacaaa cttttgaagcgaggctacgtgtgggagttccgcgctggagcagaggaaggcgacggattg agggagccgccggcggaagttgtggatcgcaggccgcgcgccgtcttaccgctgcaccgc gttctccgggaggccggcgatgagatcgagcggacgtaccagcgcgacttcgcggccatg tcggaccagctgcactttaccccgagcaccgcgcagcgccgcttcaccgccgtcatcgag gagctgttccgggacggcgtgaactggggccgcatcgtggtcttcttcgagttcgggagc accctgtgcgtggagagcgtgaaccaggagatggcgtcccaggtggacaacatagcaagt tggatgacggattacctgaacgggccattgcagaactggattcgggacaatggaggctgg gatgcctttgtggagctctacagtcatcagagagcgtccatgttccacccctggccatat ttaaagacagtctttggcctggcagcattgggagcagcgggagtcaccatcggcgccctc ttttctcaaaagtga

DBGET integrated database retrieval system