Ixodes scapularis (black-legged tick): 8041684 Help Entry 8041684           CDS       T01131                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism isc  Ixodes scapularis (black-legged tick) Pathway isc03008   Ribosome biogenesis in eukaryotes isc03013   Nucleocytoplasmic transport isc03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:isc00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     8041684    03008 Ribosome biogenesis in eukaryotes     8041684   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     8041684  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:isc03019]     8041684    03009 Ribosome biogenesis [BR:isc03009]     8041684    03016 Transfer RNA biogenesis [BR:isc03016]     8041684    03036 Chromosome and associated proteins [BR:isc03036]     8041684   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:isc04147]     8041684    04031 GTP-binding proteins [BR:isc04031]     8041684 Messenger RNA biogenesis [BR:isc03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      8041684 Ribosome biogenesis [BR:isc03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     8041684   Pre-60S particles     8041684 Transfer RNA biogenesis [BR:isc03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     8041684 Chromosome and associated proteins [BR:isc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      8041684    Spindle formation proteins     8041684 Exosome [BR:isc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    8041684 GTP-binding proteins [BR:isc04031]  Small (monomeric) G-proteins   Ran Family    Ran     8041684 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RNA_helicase ArgoMid AAA_24 Gtr1_RagA AAA_7 AAA_16 Pox_A32 DUF5906 TsaE Motif Other DBs NCBI-GeneID:  8041684 NCBI-ProteinID:  XP_002414923 UniProt:  B7QIB6 LinkDB All DBs Position Unknown AA seq 221 aa AA seqDB search MQQPLTDQGDCTPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLLFHTNR GPIRFNVWDTAGQEKFGGLRDGYYIQGQCAIVMFDVTSRVTYKNVPNWHRDLVRVCENIP IVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEF VAMPALAPPEVTMDPEWQAKLENDMKEAQNTSLPDEDDDDL NT seq 666 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcctttaacagaccagggcgactgcacgcccacattcaaatgtgtgcttgtt ggtgatggtgggactgggaagaccacatttgtgaagcggcatctcacgggagagtttgag aagaaatatgttgccactttgggtgtggaggtgcatccactcctgttccacacaaacaga ggacccattcgctttaatgtctgggacaccgcaggccaggaaaagtttggagggcttcgt gatggctactacattcaaggtcagtgcgccatcgtgatgtttgacgtgacgtcgcgagtg acgtacaagaacgtgcccaactggcatcgggatctggttcgggtctgcgagaacatcccc atcgtcctgtgtggcaacaaggtggacatcaaggaccgcaaggtcaaggcaaagtccatc gtcttccaccgcaaaaagaacctccagtactatgacatcagtgccaagagcaactacaac tttgagaagcccttcctctggctggcacgcaagctgattggcgacccgaacctggagttt gtggccatgcccgccctggctccccccgaagtaacgatggacccagagtggcaggccaag ctggagaacgacatgaaggaggcgcagaacacctctttgcccgacgaagacgacgacgac ctctaa

DBGET integrated database retrieval system