Jatropha curcas (Barbados nut): 105637971 Help Entry 105637971         CDS       T03922                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism jcu  Jatropha curcas (Barbados nut) Pathway jcu03420   Nucleotide excision repair jcu04120   Ubiquitin mediated proteolysis jcu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:jcu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     105637971    04120 Ubiquitin mediated proteolysis     105637971   09124 Replication and repair    03420 Nucleotide excision repair     105637971  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:jcu04121]     105637971    03400 DNA repair and recombination proteins [BR:jcu03400]     105637971 Enzymes [BR:jcu01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      105637971 Ubiquitin system [BR:jcu04121]  Ubiquitin ligases (E3)   UBL E3 ligases    105637971   Multi subunit type E3    SCF complex     Ring finger protein      105637971    Cul2 complex      105637971    Cul3 complex      105637971    Cul4 complex      105637971    Cul7 complex      105637971    Cul8 complex      105637971    Cul9 complex      105637971 DNA repair and recombination proteins [BR:jcu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       105637971     TCR (transcription coupled repair) factors      Cul4-CSA complex       105637971 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  105637971 NCBI-ProteinID:  NP_001295654 UniProt:  D6BRE8 LinkDB All DBs AA seq 118 aa AA seqDB search MATLDSDVAMVPVGEASSSAASSSSSKKTKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgactttggattccgatgtcgctatggttccagtcggcgaggcatcgagcagcgct gcttcctcttcctcttccaagaagaccaagcgattcgagatcaaaaagtggagtgccgtc gccctctgggcctgggatattgttgttgacaattgtgctatttgtcggaaccacattatg gatctctgtattgagtgccaagcgaaccaggctagtgccactagcgaggaatgcactgtt gcttggggggtctgcaaccacgcgtttcattttcactgcattagccggtggctcaagacc cgtcaagtgtgtccattggataatagcgaatgggaattccagaagtacggacattag

DBGET integrated database retrieval system