Juglans regia (English walnut): 108997836 Help Entry 108997836         CDS       T05245                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism jre  Juglans regia (English walnut) Pathway jre00510   N-Glycan biosynthesis jre00513   Various types of N-glycan biosynthesis jre04141   Protein processing in endoplasmic reticulum Module jre_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:jre00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     108997836    00513 Various types of N-glycan biosynthesis     108997836  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108997836 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 LapA_dom Motif Other DBs NCBI-GeneID:  108997836 NCBI-ProteinID:  XP_018829770 UniProt:  A0A2I4FDP6 LinkDB All DBs Position 10:complement(26875875..26878427) Genome browser AA seq 76 aa AA seqDB search MAPKPITSPVPDAWYPTLSVFMLAIGLVVTASFFIYEATSSRRNRSLTKELITGAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcgccgaaaccgattaccagtcccgtaccagacgcctggtacccaactctgtcagtc ttcatgctcgcgatcggtctcgtggtcaccgcctccttcttcatttatgaagcaacctct tctaggcggaaccgaagtcttaccaaggagcttatcacaggagcagtggcttctgtcttc ctgggttttgggtccttgttcttgctgcttgcttctggtgtttatgtctga

DBGET integrated database retrieval system