Juglans regia (English walnut): 109009026 Help Entry 109009026         CDS       T05245                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism jre  Juglans regia (English walnut) Pathway jre03420   Nucleotide excision repair jre04120   Ubiquitin mediated proteolysis jre04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:jre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109009026    04120 Ubiquitin mediated proteolysis     109009026   09124 Replication and repair    03420 Nucleotide excision repair     109009026  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:jre04121]     109009026    03400 DNA repair and recombination proteins [BR:jre03400]     109009026 Enzymes [BR:jre01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109009026 Ubiquitin system [BR:jre04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109009026   Multi subunit type E3    SCF complex     Ring finger protein      109009026    Cul2 complex      109009026    Cul3 complex      109009026    Cul4 complex      109009026    Cul7 complex      109009026    Cul8 complex      109009026    Cul9 complex      109009026 DNA repair and recombination proteins [BR:jre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109009026     TCR (transcription coupled repair) factors      Cul4-CSA complex       109009026 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  109009026 NCBI-ProteinID:  XP_018844896 UniProt:  A0A833YC44 A0A2I4GLX3 LinkDB All DBs Position 1:complement(34206126..34210490) Genome browser AA seq 118 aa AA seqDB search MATLDSDVPMVPAGEPSSSSVPSSSTKKNKRLEIKKWNAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgaccttggactccgacgtgcccatggtccccgctggcgagccctcgagcagctcc gtcccttcctcctccaccaaaaagaacaaacgcttagagatcaagaagtggaatgccgtc gctctttgggcctgggatatcgtggttgataactgtgccatttgcagaaaccatatcatg gatctatgcattgagtgccaagctaaccaggctagtgccactagcgaggaatgtacagtt gcttggggggtttgtaaccatgcctttcatttccactgcatcagccgatggctcaagacc cgtcaagtatgtccattagataacagcgaatgggagtttcagaagtatggtcactag

DBGET integrated database retrieval system