Kribbella flavida: Kfla_5968 Help Entry Kfla_5968         CDS       T01155                                  Name (GenBank) Dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism kfl  Kribbella flavida Pathway kfl00670   One carbon pool by folate kfl00790   Folate biosynthesis kfl01100   Metabolic pathways kfl01240   Biosynthesis of cofactors kfl04981   Folate transport and metabolism Module kfl_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:kfl00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Kfla_5968    00670 One carbon pool by folate     Kfla_5968  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     Kfla_5968 Enzymes [BR:kfl01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      Kfla_5968 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  ADB34971 UniProt:  D2PSR9 LinkDB All DBs Position 6409643..6410104 Genome browser AA seq 153 aa AA seqDB search MSVVLIAAVGRNGVIGRDNELPWRIREDLQHFKALTLGHTLVMGRKTYDSIGRPLPGRRT VVVTRQPDWSAPGVEVAHSLAAALELADGKDVYVAGGGEIYRQALPSADRLELTEVDQSP AGDVTFPAVDRSAWTETAREPHDGFAFVTYVRS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgagcgtcgtactgatcgcggcggtcggtcgcaacggcgtgatcggccgggacaacgag ctgccctggcgcatccgcgaggacctccagcacttcaaggccctcaccctgggccacacc ctggtgatgggccgcaagacctacgactcgatcggccgcccgctgcccggacgccggacg gtcgtggtcacccggcagccggactggtccgcgcccggcgtcgaggtcgcgcacagcctg gccgccgcgctcgagcttgccgacggcaaggacgtctacgtggccggcggcggcgagatc taccgtcaggcgctgccgtccgccgaccggctggagctgaccgaggtcgaccagtccccc gcgggcgacgtcaccttccccgccgtcgaccgctccgcctggaccgagaccgcccgcgaa ccgcacgacggcttcgccttcgtcacctacgtccggtcctga

DBGET integrated database retrieval system