Klebsiella sp. CTHL.F3a: K7H21_23720 Help Entry K7H21_23720       CDS       T08882                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism klc  Klebsiella sp. CTHL.F3a Pathway klc00670   One carbon pool by folate klc00790   Folate biosynthesis klc01100   Metabolic pathways klc01240   Biosynthesis of cofactors klc04981   Folate transport and metabolism Module klc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:klc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     K7H21_23720 (folA)    00670 One carbon pool by folate     K7H21_23720 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     K7H21_23720 (folA) Enzymes [BR:klc01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      K7H21_23720 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 DUF7466 Motif Other DBs NCBI-ProteinID:  QZY79295 LinkDB All DBs Position complement(5064934..5065413) Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI VISSQPGTDERVEWVKSVDEAIAACGDVEEMMVIGGGRVYEQFLPKAHKLYLTHIDAEVE GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcagtctgattgcggcgttagcggtagatcgcgtcattggtatggaaaacgccatg ccatggaacctgcctgccgatctcgcctggtttaagcgcaataccttaaacaaaccggta gtgatgggacgtcttacctgggaatccatcggtcgtccgttaccgggacgtaaaaatatc gtgattagcagccagcccggcaccgacgagcgcgtggagtgggtcaaatcggtcgatgaa gctattgccgcctgcggcgacgtggaagagatgatggtgatcggcggcggtcgcgtgtat gagcagttcctgccgaaagcacacaagctctatctgacgcatattgatgcggaagtggag ggcgatactcatttcccggattacgacccggacgagtgggagtcggtattcagcgagttc cacgatgccgatgcgcagaattcccatagctactgcttcgagattctggagcgccgctaa

DBGET integrated database retrieval system