Klebsiella michiganensis RC10: VW41_03320 Help Entry VW41_03320        CDS       T03782                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism kmi  Klebsiella michiganensis RC10 Pathway kmi00670   One carbon pool by folate kmi00790   Folate biosynthesis kmi01100   Metabolic pathways kmi01240   Biosynthesis of cofactors kmi04981   Folate transport and metabolism Module kmi_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:kmi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     VW41_03320 (folA)    00670 One carbon pool by folate     VW41_03320 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     VW41_03320 (folA) Enzymes [BR:kmi01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      VW41_03320 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 DUF7466 Motif Other DBs NCBI-ProteinID:  AJZ88144 LinkDB All DBs Position 692925..693404 Genome browser AA seq 159 aa AA seqDB search MISLIAALAVDRVIGMENAMPWDLPGDLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI VISSKAGNDDRVEWVKSVEEAIKACGDAEEIMVIGGGRVYEQFLPKAQRLYLTHIDAEVE GDTHFPDYDPDEWQSTFSEFHDADENNSHGYCFEILERR NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgatcagtctgattgctgctttagcggtggatcgcgttatcggcatggaaaacgccatg ccatgggatttgcctggcgacctggcctggttcaagcgcaatacgctaaataagcccgtt gttatgggccgcctgacctgggagtctattggccgcccgctgcctggtcgtaaaaatatc gtgatcagcagtaaagccggaaatgacgatcgcgttgagtgggtgaaatcggttgaagag gctatcaaagcctgtggtgatgccgaagaaatcatggtgattggcgggggacgcgtatac gagcaattcctgccaaaggcgcagcgcctctacctgacccatattgatgcggaagtagaa ggggacacgcatttcccggattacgatccggacgagtggcagtcaaccttcagcgaattc cacgatgccgatgagaataactcccacggctactgctttgaaattctggaacgtcgctaa

DBGET integrated database retrieval system