Kluyveromyces marxianus: KLMA_70161 Help Entry KLMA_70161        CDS       T05269                                  Symbol HRT1 Name (RefSeq) RING-box protein HRT1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism kmx  Kluyveromyces marxianus Pathway kmx03420   Nucleotide excision repair kmx04111   Cell cycle - yeast kmx04120   Ubiquitin mediated proteolysis kmx04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:kmx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     KLMA_70161 (HRT1)    04120 Ubiquitin mediated proteolysis     KLMA_70161 (HRT1)   09124 Replication and repair    03420 Nucleotide excision repair     KLMA_70161 (HRT1)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     KLMA_70161 (HRT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:kmx04121]     KLMA_70161 (HRT1)    03400 DNA repair and recombination proteins [BR:kmx03400]     KLMA_70161 (HRT1) Enzymes [BR:kmx01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      KLMA_70161 (HRT1) Ubiquitin system [BR:kmx04121]  Ubiquitin ligases (E3)   UBL E3 ligases    KLMA_70161 (HRT1)   Multi subunit type E3    SCF complex     Ring finger protein      KLMA_70161 (HRT1)    Cul2 complex      KLMA_70161 (HRT1)    Cul3 complex      KLMA_70161 (HRT1)    Cul4 complex      KLMA_70161 (HRT1)    Cul7 complex      KLMA_70161 (HRT1)    Cul8 complex      KLMA_70161 (HRT1)    Cul9 complex      KLMA_70161 (HRT1) DNA repair and recombination proteins [BR:kmx03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       KLMA_70161 (HRT1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       KLMA_70161 (HRT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 RH_dom zf-Nse zf-RING_5 SLX1_C Motif Other DBs NCBI-GeneID:  34717918 NCBI-ProteinID:  XP_022677774 UniProt:  W0TIP4 LinkDB All DBs Position 7:334249..334575 Genome browser AA seq 108 aa AA seqDB search MATDIDPREAQVDSPQDAKPNFEITKWTAVAFWSWDIDVDNCAICRNHIMEPCVNCQQEA TFNSEHECVAAWGECNHAFHLHCITQWIKSRNVCPLDNKPWKLARCGK NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggctacagatatagacccaagggaagcacaggtggattcgcctcaggacgctaagcca aacttcgaaataactaagtggacagcagttgcattttggtcgtgggatatcgacgtggat aactgtgccatttgcagaaatcatatcatggaaccctgtgtgaactgtcagcaggaggct actttcaattcagaacacgaatgtgtggctgcatggggtgagtgtaaccatgcgttccat ctacattgcattacacaatggatcaagagcagaaatgtatgtccgttggataataaaccc tggaagcttgcccggtgcggcaagtaa

DBGET integrated database retrieval system