Kwoniella newhampshirensis: 92177641 Help Entry 92177641          CDS       T10314                                  Symbol IAR55_000381 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism kne  Kwoniella newhampshirensis Pathway kne03420   Nucleotide excision repair kne04111   Cell cycle - yeast kne04120   Ubiquitin mediated proteolysis kne04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:kne00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     92177641 (IAR55_000381)    04120 Ubiquitin mediated proteolysis     92177641 (IAR55_000381)   09124 Replication and repair    03420 Nucleotide excision repair     92177641 (IAR55_000381)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     92177641 (IAR55_000381)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:kne04121]     92177641 (IAR55_000381)    03400 DNA repair and recombination proteins [BR:kne03400]     92177641 (IAR55_000381) Enzymes [BR:kne01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      92177641 (IAR55_000381) Ubiquitin system [BR:kne04121]  Ubiquitin ligases (E3)   UBL E3 ligases    92177641 (IAR55_000381)   Multi subunit type E3    SCF complex     Ring finger protein      92177641 (IAR55_000381)    Cul2 complex      92177641 (IAR55_000381)    Cul3 complex      92177641 (IAR55_000381)    Cul4 complex      92177641 (IAR55_000381)    Cul7 complex      92177641 (IAR55_000381)    Cul8 complex      92177641 (IAR55_000381)    Cul9 complex      92177641 (IAR55_000381) DNA repair and recombination proteins [BR:kne03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       92177641 (IAR55_000381)     TCR (transcription coupled repair) factors      Cul4-CSA complex       92177641 (IAR55_000381) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 Motif Other DBs NCBI-GeneID:  92177641 NCBI-ProteinID:  XP_066806059 UniProt:  A0AAW0Z6L2 LinkDB All DBs Position 1:complement(<1005286..>1006198) Genome browser AA seq 112 aa AA seqDB search MDVDTPTSSSAGQVAKSGGGHEQKPRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQGADNEGCTVAWGICNHAFHFHCISRWLKTRHVCPLDNRQWELQKYGR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggacgtcgacactcctacttcttcatctgctgggcaagtggcaaaatcaggaggagga catgaacagaagccgagattcgaggtgaagaagtggaatgctgtcgctctttgggcttgg gatatcgtcgttgacaattgcgctatctgtcgtaatcacatcatggacctttgtatcgaa tgtcaagcgaaccaaggggcagataatgagggatgtacggtcgcctggggtatctgtaac cacgcattccacttccactgtatctcgcgatggctcaagactcgacatgtctgcccactc gataatcgacaatgggaactgcagaaatacggtcgatag

DBGET integrated database retrieval system