Huiozyma naganishii: KNAG_0A01280 Help Entry KNAG_0A01280      CDS       T08174                                  Symbol KNAG0A01280 Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism kng  Huiozyma naganishii Pathway kng03420   Nucleotide excision repair kng04111   Cell cycle - yeast kng04120   Ubiquitin mediated proteolysis kng04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:kng00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     KNAG_0A01280 (KNAG0A01280)    04120 Ubiquitin mediated proteolysis     KNAG_0A01280 (KNAG0A01280)   09124 Replication and repair    03420 Nucleotide excision repair     KNAG_0A01280 (KNAG0A01280)  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     KNAG_0A01280 (KNAG0A01280)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:kng04121]     KNAG_0A01280 (KNAG0A01280)    03400 DNA repair and recombination proteins [BR:kng03400]     KNAG_0A01280 (KNAG0A01280) Enzymes [BR:kng01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      KNAG_0A01280 (KNAG0A01280) Ubiquitin system [BR:kng04121]  Ubiquitin ligases (E3)   UBL E3 ligases    KNAG_0A01280 (KNAG0A01280)   Multi subunit type E3    SCF complex     Ring finger protein      KNAG_0A01280 (KNAG0A01280)    Cul2 complex      KNAG_0A01280 (KNAG0A01280)    Cul3 complex      KNAG_0A01280 (KNAG0A01280)    Cul4 complex      KNAG_0A01280 (KNAG0A01280)    Cul7 complex      KNAG_0A01280 (KNAG0A01280)    Cul8 complex      KNAG_0A01280 (KNAG0A01280)    Cul9 complex      KNAG_0A01280 (KNAG0A01280) DNA repair and recombination proteins [BR:kng03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       KNAG_0A01280 (KNAG0A01280)     TCR (transcription coupled repair) factors      Cul4-CSA complex       KNAG_0A01280 (KNAG0A01280) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-RING_11 PHD_NSD zf-RING_Vps41 DUF5348 Motif Other DBs NCBI-GeneID:  34523452 NCBI-ProteinID:  XP_022462063 UniProt:  J7RT02 LinkDB All DBs Position 1:<27372..>27716 Genome browser AA seq 114 aa AA seqDB search MSEVEKMEVDSDAAQGAPVAGQAAKKKFQIKKWTAVAFWSWDIAVDNCAICRNHIMEPCI ECQPKAMTDTDNECVAAWGACGHAFHLHCINKWIKTRDACPLDNQPWQLARCGR NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagtggaaaagatggaggtagactcagatgcagcgcaaggtgcccccgtggcg ggccaagctgcgaaaaagaagtttcagatcaagaaatggaccgcggtggccttctggtcg tgggatattgctgtagacaactgtgccatctgcaggaatcacatcatggagccatgcatt gagtgtcagccgaaggcaatgaccgacacggacaacgaatgtgtcgccgcgtggggtgcg tgtggccacgcattccacttgcattgtattaacaaatggatcaagacaagagacgcgtgt cccctcgataatcaaccctggcagctggctcgctgtggccgatga

DBGET integrated database retrieval system