KEGG   Kitasatospora setae: KSE_03600
Entry
KSE_03600         CDS       T01648                                 
Name
(GenBank) putative cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
ksk  Kitasatospora setae
Pathway
ksk00909  Sesquiterpenoid and triterpenoid biosynthesis
ksk00998  Biosynthesis of various antibiotics
ksk01100  Metabolic pathways
ksk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ksk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    KSE_03600
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    KSE_03600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ksk00199]
    KSE_03600
Enzymes [BR:ksk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     KSE_03600
Cytochrome P450 [BR:ksk00199]
 Cytochrome P450, bacteria type
  CYP183 family
   KSE_03600
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: BAJ26207
NITE: KSE_03600
UniProt: E4N4S6
LinkDB
Position
401805..403202
AA seq 465 aa
MSQTAAVPAVPAFTAATAPGALPLLGHGHRLLSGPVDFLSSLHAHGDLVAVRLGPTTAQV
PCHPALLARVLGDDRLFDKGGVFYDRARDVAGNGLVTCPYGDHRRQRRLVQSAFRRSQLA
HYAGAAQAEVDAAAADWRPGLVVDAFPLFYGIALRTLARTLYSTAISAELAAGVERSFDT
VLNGLFRQMFLPAPVRRLPLPANLRYRRSLAYLHAATRQLITSYRSERGDRGDRTPGDEG
ATDLLSALLDAVDEEGGGSGLSDAEVHDQVITLLAAGTETVAATLTWALWRLSLHPAAAE
QVRAELAGVLPGGRPPTPEDLPRLAAVDRVLSETLRLHPPGWLFTRLTTAPTELAGRELP
PGTTLVFSPAAVSRHPAAYDSPAVFDPDRWRPERVTPAARQAFLPFGTGARKCVGDLFAR
TECAVALATLLSRWRFTPEPDADLRPVPLATVLRPRRLRLRVAER
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgtcgcagaccgccgccgtccccgccgtccccgctttcaccgccgcgaccgcacccggt
gccctgccgctgctcgggcacgggcaccgactgctgagcgggccggtcgacttcctgtcc
tcgctgcacgcgcacggcgacctggtggcggtccggctggggccgacgacggcccaggtg
ccctgccacccggcgctgctggcaagggtgttgggcgacgaccggctcttcgacaagggc
ggggtgttctacgaccgggcccgcgacgtggccggcaacgggctggtcacctgcccgtac
ggggaccaccggaggcagcggcgactggtccaatcggccttccggcgctcgcagttggcg
cactacgcgggagccgcgcaggccgaggtggacgccgccgcggccgactggcggcccggc
ctggtggtcgacgcgttcccgctgttctacggcatcgcgctgcgcacgctggcccggacg
ctctactcgaccgcgatcagcgccgagttggcggccggcgtggaacgctccttcgacacc
gtgctgaacgggctgttccggcagatgttcctgcccgcgccggtccgccgcctgccgctg
cccgccaacctgcgctaccgccgctcgctggcctacctgcacgccgccacccggcagttg
atcacctcgtaccggagcgaacgaggcgaccggggcgaccggactcccggggacgagggc
gccaccgacctgctctcggcgctgctggacgccgtcgacgaggagggcggcgggtcgggg
ctgagcgacgccgaggtgcacgaccaggtgatcacgctgctcgcggccgggacggagacc
gtcgccgccaccctgacctgggcgctgtggcggctgtcgctgcacccggcggcggccgag
caggtccgggccgagctggccggggtgctgcccggcgggcggccgccgaccccggaggac
ctgccgcggctggcggccgtcgaccgggtgctgtcggagacgctgcggctgcacccgccg
ggctggctgttcacccggctgaccaccgcgccgaccgagctcgccggccgcgaactcccg
cccggcaccacgctggtgttctccccggcggcggtctcccggcacccggccgcgtacgac
tcccccgccgtcttcgacccggaccgctggcgcccggagcgggtcaccccggccgcccgg
caggcgttcctgccgttcggcaccggggcccgcaagtgcgtcggcgacctgttcgcccgg
accgagtgcgccgtcgccctggccaccctgctgtcccgctggcggttcaccccggagccg
gacgccgacctgcgccccgtcccgctggcgacggtgctgcgcccgcggcggctccggctg
cgggtcgccgaacgctga

DBGET integrated database retrieval system