Lingula anatina: 106154304 Help Entry 106154304         CDS       T04921                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism lak  Lingula anatina Pathway lak00510   N-Glycan biosynthesis lak00513   Various types of N-glycan biosynthesis lak04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lak00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     106154304    00513 Various types of N-glycan biosynthesis     106154304  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     106154304 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 TctB DUF6512 Motif Other DBs NCBI-GeneID:  106154304 NCBI-ProteinID:  XP_013384077 UniProt:  A0A1S3HDG0 LinkDB All DBs Position Unknown AA seq 80 aa AA seqDB search MLDVEQMTRYVSPINPATFPHLTVVLLGIGLFFMAWFFVYEATSTKYTRDLYKEILVSLV ASIFMGFGILFLLLWVGIYV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgttggacgttgaacagatgacccgctatgtgtctcccatcaatcctgccaccttccca caccttactgtggtgctgctaggaataggacttttcttcatggcatggttttttgtatat gaagctacttcaacaaaatacaccagagatttatataaggaaatcctagtttcattagtt gcatccatttttatgggatttggtattttatttctcctactgtgggttgggatatatgta tag

DBGET integrated database retrieval system