Lingula anatina: 106173214 Help Entry 106173214         CDS       T04921                                  Name (RefSeq) dihydrofolate reductase-like   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism lak  Lingula anatina Pathway lak00670   One carbon pool by folate lak00790   Folate biosynthesis lak01100   Metabolic pathways lak01240   Biosynthesis of cofactors lak04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:lak00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     106173214    00670 One carbon pool by folate     106173214  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     106173214 Enzymes [BR:lak01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      106173214 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  106173214 NCBI-ProteinID:  XP_013409720 UniProt:  A0A1S3JH35 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MPDVKLNLVVAMCNNRGIGINGQLPWRLRGDMNFFKKITSETKDPEKKNAVIMGRKTWFS IPEKFRPLANRINVVLSREMKDSPDGAHLSRSLEDALSLLSTPPLSDKVESLFVIGGSAI YEVDLYTSCSRHISLTKEL NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgccagatgttaagctgaacttggtagttgccatgtgcaacaacaggggcattggtata aacggtcaattaccttggaggttaaggggagatatgaattttttcaagaaaattacatca gaaacaaaagacccagaaaagaaaaatgctgtcattatgggaaggaaaacatggttctct ataccagagaaatttagaccacttgccaacagaataaatgtagttctcagtagagaaatg aaagatagtccagatggagctcatttatctagaagtcttgaagatgctttgagtcttctg tcaactccacctttgtcagataaagtggagagcttgtttgtcattggtggaagtgcaata tatgaggtagatctatacactagctgctctaggcatattagtttaaccaaggagttataa

DBGET integrated database retrieval system