Lycium barbarum (goji berry): 132645335 Help Entry 132645335         CDS       T09483                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lbb  Lycium barbarum (goji berry) Pathway lbb03420   Nucleotide excision repair lbb04120   Ubiquitin mediated proteolysis lbb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lbb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132645335    04120 Ubiquitin mediated proteolysis     132645335   09124 Replication and repair    03420 Nucleotide excision repair     132645335  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lbb04121]     132645335    03400 DNA repair and recombination proteins [BR:lbb03400]     132645335 Enzymes [BR:lbb01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      132645335 Ubiquitin system [BR:lbb04121]  Ubiquitin ligases (E3)   UBL E3 ligases    132645335   Multi subunit type E3    SCF complex     Ring finger protein      132645335    Cul2 complex      132645335    Cul3 complex      132645335    Cul4 complex      132645335    Cul7 complex      132645335    Cul8 complex      132645335    Cul9 complex      132645335 DNA repair and recombination proteins [BR:lbb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       132645335     TCR (transcription coupled repair) factors      Cul4-CSA complex       132645335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  132645335 NCBI-ProteinID:  XP_060218256 LinkDB All DBs Position 1:complement(153647424..153652482) Genome browser AA seq 120 aa AA seqDB search MDTDVEMAPAGEGSTVAVPSTASSSSSTKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatacagacgtagaaatggctcctgctggtgaaggatccaccgttgccgtaccttca acagcttcttcttcttcttctacgaagaaaccaaagcgttttgagatcaaaaagtggaac gctgtctctttatgggcttgggatattgttgtggacaactgtgctatttgcaggaaccac atcatggacctctgcattgaatgtcaagctaatcaagctagtgctactagcgaggagtgc actgttgcctggggtgtatgtaatcatgccttccactttcactgcattagtcgatggctc aaaacccgtcaagtgtgcccattagataacagtgagtgggagtttcagaagtatggtcac tag

DBGET integrated database retrieval system