Lemur catta (Ring-tailed lemur): 123631724 Help Entry 123631724         CDS       T08326                                  Symbol TNF Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat01523   Antifolate resistance lcat04010   MAPK signaling pathway lcat04060   Cytokine-cytokine receptor interaction lcat04061   Viral protein interaction with cytokine and cytokine receptor lcat04064   NF-kappa B signaling pathway lcat04071   Sphingolipid signaling pathway lcat04150   mTOR signaling pathway lcat04210   Apoptosis lcat04217   Necroptosis lcat04350   TGF-beta signaling pathway lcat04380   Osteoclast differentiation lcat04612   Antigen processing and presentation lcat04620   Toll-like receptor signaling pathway lcat04621   NOD-like receptor signaling pathway lcat04622   RIG-I-like receptor signaling pathway lcat04625   C-type lectin receptor signaling pathway lcat04640   Hematopoietic cell lineage lcat04650   Natural killer cell mediated cytotoxicity lcat04657   IL-17 signaling pathway lcat04660   T cell receptor signaling pathway lcat04664   Fc epsilon RI signaling pathway lcat04668   TNF signaling pathway lcat04920   Adipocytokine signaling pathway lcat04930   Type II diabetes mellitus lcat04931   Insulin resistance lcat04932   Non-alcoholic fatty liver disease lcat04933   AGE-RAGE signaling pathway in diabetic complications lcat04936   Alcoholic liver disease lcat04940   Type I diabetes mellitus lcat05010   Alzheimer disease lcat05014   Amyotrophic lateral sclerosis lcat05020   Prion disease lcat05022   Pathways of neurodegeneration - multiple diseases lcat05132   Salmonella infection lcat05133   Pertussis lcat05134   Legionellosis lcat05135   Yersinia infection lcat05140   Leishmaniasis lcat05142   Chagas disease lcat05143   African trypanosomiasis lcat05144   Malaria lcat05145   Toxoplasmosis lcat05146   Amoebiasis lcat05152   Tuberculosis lcat05160   Hepatitis C lcat05161   Hepatitis B lcat05163   Human cytomegalovirus infection lcat05164   Influenza A lcat05165   Human papillomavirus infection lcat05166   Human T-cell leukemia virus 1 infection lcat05168   Herpes simplex virus 1 infection lcat05169   Epstein-Barr virus infection lcat05170   Human immunodeficiency virus 1 infection lcat05171   Coronavirus disease - COVID-19 lcat05205   Proteoglycans in cancer lcat05310   Asthma lcat05321   Inflammatory bowel disease lcat05322   Systemic lupus erythematosus lcat05323   Rheumatoid arthritis lcat05330   Allograft rejection lcat05332   Graft-versus-host disease lcat05410   Hypertrophic cardiomyopathy lcat05414   Dilated cardiomyopathy lcat05417   Lipid and atherosclerosis lcat05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123631724 (TNF)    04350 TGF-beta signaling pathway     123631724 (TNF)    04064 NF-kappa B signaling pathway     123631724 (TNF)    04668 TNF signaling pathway     123631724 (TNF)    04071 Sphingolipid signaling pathway     123631724 (TNF)    04150 mTOR signaling pathway     123631724 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     123631724 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     123631724 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     123631724 (TNF)    04217 Necroptosis     123631724 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     123631724 (TNF)    04620 Toll-like receptor signaling pathway     123631724 (TNF)    04621 NOD-like receptor signaling pathway     123631724 (TNF)    04622 RIG-I-like receptor signaling pathway     123631724 (TNF)    04625 C-type lectin receptor signaling pathway     123631724 (TNF)    04650 Natural killer cell mediated cytotoxicity     123631724 (TNF)    04612 Antigen processing and presentation     123631724 (TNF)    04660 T cell receptor signaling pathway     123631724 (TNF)    04657 IL-17 signaling pathway     123631724 (TNF)    04664 Fc epsilon RI signaling pathway     123631724 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     123631724 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     123631724 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     123631724 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123631724 (TNF)    05170 Human immunodeficiency virus 1 infection     123631724 (TNF)    05161 Hepatitis B     123631724 (TNF)    05160 Hepatitis C     123631724 (TNF)    05171 Coronavirus disease - COVID-19     123631724 (TNF)    05164 Influenza A     123631724 (TNF)    05168 Herpes simplex virus 1 infection     123631724 (TNF)    05163 Human cytomegalovirus infection     123631724 (TNF)    05169 Epstein-Barr virus infection     123631724 (TNF)    05165 Human papillomavirus infection     123631724 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     123631724 (TNF)    05135 Yersinia infection     123631724 (TNF)    05133 Pertussis     123631724 (TNF)    05134 Legionellosis     123631724 (TNF)    05152 Tuberculosis     123631724 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     123631724 (TNF)    05144 Malaria     123631724 (TNF)    05145 Toxoplasmosis     123631724 (TNF)    05140 Leishmaniasis     123631724 (TNF)    05142 Chagas disease     123631724 (TNF)    05143 African trypanosomiasis     123631724 (TNF)   09163 Immune disease    05310 Asthma     123631724 (TNF)    05322 Systemic lupus erythematosus     123631724 (TNF)    05323 Rheumatoid arthritis     123631724 (TNF)    05321 Inflammatory bowel disease     123631724 (TNF)    05330 Allograft rejection     123631724 (TNF)    05332 Graft-versus-host disease     123631724 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     123631724 (TNF)    05014 Amyotrophic lateral sclerosis     123631724 (TNF)    05020 Prion disease     123631724 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     123631724 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123631724 (TNF)    05418 Fluid shear stress and atherosclerosis     123631724 (TNF)    05410 Hypertrophic cardiomyopathy     123631724 (TNF)    05414 Dilated cardiomyopathy     123631724 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     123631724 (TNF)    04940 Type I diabetes mellitus     123631724 (TNF)    04936 Alcoholic liver disease     123631724 (TNF)    04932 Non-alcoholic fatty liver disease     123631724 (TNF)    04931 Insulin resistance     123631724 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     123631724 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     123631724 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcat04052]     123631724 (TNF)    00536 Glycosaminoglycan binding proteins [BR:lcat00536]     123631724 (TNF) Cytokines and neuropeptides [BR:lcat04052]  Cytokines   Tumor necrosis fators    123631724 (TNF) Glycosaminoglycan binding proteins [BR:lcat00536]  Heparan sulfate / Heparin   Cytokines    123631724 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  123631724 NCBI-ProteinID:  XP_045397593 LinkDB All DBs Position 2:41918008..41920794 Genome browser AA seq 235 aa AA seqDB search MSTESMIRDVELAEEALPKKAGGPQGSRHCVCLSLFSFLLVAGATTLFCLLHFGVIGPQR EEFPGGHRLINVNPLAQTLRSSSRTPSDKPVAHVVANPQAEAQLQWISGRANALLANGVQ LTDNQLVVPSDGLYLIYSQVLFKGPGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQ RETPEEGEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 708 nt NT seq  +upstreamnt  +downstreamnt atgagcacagagagcatgatccgggatgtggagctggccgaagaggcgcttcccaagaag gcaggggggccccagggctccaggcactgcgtatgcctcagcctcttctccttcctgctc gtggcaggagccaccacactcttctgcctgctgcacttcggggtgatcggcccccagagg gaagagttccccggtggccaccgtctaatcaacgtcaaccctctggcccagacactcaga tcatcctcccgaaccccaagtgacaagcctgtagcccatgttgtagcaaatccccaagct gaggcacagctgcagtggataagcgggcgtgccaatgccctcctggccaatggcgtgcag ctgacagacaaccagctggtggtgccgtccgacgggctatacctcatctactcccaggtc ctcttcaagggcccaggctgcccttccacccacgtgctcctcacccacaccatcagccgc tttgccgtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccag agggagaccccagaggagggtgaggccaagccctggtatgagcccatctacctgggaggg gtcttccagctggagaagggtgacagactcagtgctgagatcaatttacctgactatctc gacttcgccgagtccgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system