Lemur catta (Ring-tailed lemur): 123646534 Help Entry 123646534         CDS       T08326                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism lcat  Lemur catta (Ring-tailed lemur) Pathway lcat01522   Endocrine resistance lcat04010   MAPK signaling pathway lcat04024   cAMP signaling pathway lcat04210   Apoptosis lcat04380   Osteoclast differentiation lcat04620   Toll-like receptor signaling pathway lcat04657   IL-17 signaling pathway lcat04658   Th1 and Th2 cell differentiation lcat04659   Th17 cell differentiation lcat04660   T cell receptor signaling pathway lcat04662   B cell receptor signaling pathway lcat04668   TNF signaling pathway lcat04713   Circadian entrainment lcat04725   Cholinergic synapse lcat04728   Dopaminergic synapse lcat04915   Estrogen signaling pathway lcat04917   Prolactin signaling pathway lcat04921   Oxytocin signaling pathway lcat04926   Relaxin signaling pathway lcat04928   Parathyroid hormone synthesis, secretion and action lcat04932   Non-alcoholic fatty liver disease lcat04935   Growth hormone synthesis, secretion and action lcat05031   Amphetamine addiction lcat05132   Salmonella infection lcat05133   Pertussis lcat05135   Yersinia infection lcat05140   Leishmaniasis lcat05142   Chagas disease lcat05161   Hepatitis B lcat05162   Measles lcat05166   Human T-cell leukemia virus 1 infection lcat05167   Kaposi sarcoma-associated herpesvirus infection lcat05170   Human immunodeficiency virus 1 infection lcat05171   Coronavirus disease lcat05200   Pathways in cancer lcat05207   Chemical carcinogenesis - receptor activation lcat05208   Chemical carcinogenesis - reactive oxygen species lcat05210   Colorectal cancer lcat05224   Breast cancer lcat05231   Choline metabolism in cancer lcat05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lcat05323   Rheumatoid arthritis lcat05417   Lipid and atherosclerosis lcat05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lcat00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123646534 (FOS)    04668 TNF signaling pathway     123646534 (FOS)    04024 cAMP signaling pathway     123646534 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     123646534 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     123646534 (FOS)    04660 T cell receptor signaling pathway     123646534 (FOS)    04658 Th1 and Th2 cell differentiation     123646534 (FOS)    04659 Th17 cell differentiation     123646534 (FOS)    04657 IL-17 signaling pathway     123646534 (FOS)    04662 B cell receptor signaling pathway     123646534 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     123646534 (FOS)    04917 Prolactin signaling pathway     123646534 (FOS)    04921 Oxytocin signaling pathway     123646534 (FOS)    04926 Relaxin signaling pathway     123646534 (FOS)    04935 Growth hormone synthesis, secretion and action     123646534 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     123646534 (FOS)   09156 Nervous system    04725 Cholinergic synapse     123646534 (FOS)    04728 Dopaminergic synapse     123646534 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     123646534 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     123646534 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123646534 (FOS)    05207 Chemical carcinogenesis - receptor activation     123646534 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     123646534 (FOS)    05231 Choline metabolism in cancer     123646534 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123646534 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     123646534 (FOS)    05224 Breast cancer     123646534 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123646534 (FOS)    05170 Human immunodeficiency virus 1 infection     123646534 (FOS)    05161 Hepatitis B     123646534 (FOS)    05171 Coronavirus disease     123646534 (FOS)    05162 Measles     123646534 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     123646534 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     123646534 (FOS)    05135 Yersinia infection     123646534 (FOS)    05133 Pertussis     123646534 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     123646534 (FOS)    05142 Chagas disease     123646534 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     123646534 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     123646534 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123646534 (FOS)    05418 Fluid shear stress and atherosclerosis     123646534 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     123646534 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     123646534 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:lcat03000]     123646534 (FOS)    04131 Membrane trafficking [BR:lcat04131]     123646534 (FOS) Transcription factors [BR:lcat03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     123646534 (FOS) Membrane trafficking [BR:lcat04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     123646534 (FOS) SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 CCDC110 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  123646534 NCBI-ProteinID:  XP_045419580 LinkDB All DBs Position 1:complement(25028014..25031471) Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRSGVLKNMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPNDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISNMELKAEPFDDFMFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPESDSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaatgccgactacgaggcgtcttcctcccgctgcagcagcgct tccccggccggggacagtctctcctactaccactcacccgccgactctttctccagcatg ggctctcccgtcaatgcgcaggacttctgcacagacctggccgtctctagtgccaacttc atccccacggtgactgccatctctaccagtccagacctgcagtggctggtgcagcccact ttggtctcctccgtggccccatcgcagaccagagctccccacccctacggagtccccacc ccctccgcaggggcttactctaggagcggagtcctgaagaacatgacgggaggcagagca cagagcattggcaggaggggcaaggtggaacagctatctccagaagaagaagagaaacgg agaatccgaagggaaaggaataagatggctgcagccaagtgccgcaaccggaggagggag ctgaccgatacactccaagcggagacagaccaactagaagatgagaagtctgctctgcag actgagattgccaacctgctaaaggagaaggaaaagctagagttcatcctggcagctcac cgacctgcctgcaagatccccaatgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgagtgggggcctgccggaggctgccaccccagagtctgaggaggccttcacc ctacccctcctcaatgaccctgagcccaagccctcggtggagcccgtcaagagcatcagc aacatggagctgaaggccgagccctttgatgacttcatgttcccagcatcgtccaggccc agcggctctgagacagcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacagcggctccctggggatggggcccatggccacagagctg gagccgctgtgcaccccggtggtcacctgcactcccagctgcaccacttacacgtcttcc tttgtcttcacctacccggagtctgactccttccccagctgcgcggctgcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctcacccacactgctggccctg tga

DBGET integrated database retrieval system