Legionella clemsonensis: clem_11700 Help Entry clem_11700        CDS       T05016                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism lcd  Legionella clemsonensis Pathway lcd00790   Folate biosynthesis lcd01100   Metabolic pathways lcd01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:lcd00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     clem_11700 (folB) Enzymes [BR:lcd01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      clem_11700 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      clem_11700 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      clem_11700 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF5735 Motif Other DBs NCBI-ProteinID:  ASQ46877 UniProt:  A0A222P4Y0 LinkDB All DBs Position 2624655..2624993 Genome browser AA seq 112 aa AA seqDB search MDLLQIKGLCVLTRIGVHAWEQQILQRLYIDISIPGNFTACNDDITNTIDYDKLCQTVTA YIESHSFCLIETVADKVANLIKQEFAIPQLTVSVSKPHAIKNASDIRVTVTR NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatcttcttcagataaaaggtttgtgcgtgttaactcgtattggggttcacgcttgg gaacaacaaatattacaacgtttatatatagatatctccataccaggcaacttcactgcc tgcaatgatgatattaccaacacgattgattacgacaaactttgtcaaactgttaccgct tatattgaatcgcactctttctgtcttatagaaacggttgcagacaaggttgcgaattta attaaacaggaatttgctatcccgcaattaactgttagtgtaagtaaacctcatgccatc aagaatgccagcgacattcgagttactgtaacccgctaa

DBGET integrated database retrieval system