Lates calcarifer (barramundi perch): 108877581 Help Entry 108877581         CDS       T04895                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lcf  Lates calcarifer (barramundi perch) Pathway lcf03420   Nucleotide excision repair lcf04110   Cell cycle lcf04114   Oocyte meiosis lcf04120   Ubiquitin mediated proteolysis lcf04141   Protein processing in endoplasmic reticulum lcf04310   Wnt signaling pathway lcf04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:lcf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108877581    04120 Ubiquitin mediated proteolysis     108877581   09124 Replication and repair    03420 Nucleotide excision repair     108877581  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108877581    04350 TGF-beta signaling pathway     108877581  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     108877581    04114 Oocyte meiosis     108877581  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lcf04121]     108877581    03400 DNA repair and recombination proteins [BR:lcf03400]     108877581 Enzymes [BR:lcf01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      108877581 Ubiquitin system [BR:lcf04121]  Ubiquitin ligases (E3)   UBL E3 ligases    108877581   Multi subunit type E3    SCF complex     Ring finger protein      108877581    Cul2 complex      108877581    Cul3 complex      108877581    Cul4 complex      108877581    Cul7 complex      108877581    Cul8 complex      108877581    Cul9 complex      108877581 DNA repair and recombination proteins [BR:lcf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       108877581     TCR (transcription coupled repair) factors      Cul4-CSA complex       108877581 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  108877581 NCBI-ProteinID:  XP_018523181 UniProt:  A0A4W6DF30 LinkDB All DBs Position LG11:complement(16604597..16607468) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgtagatacgccgagcggcacaaacagtggagcaagcaagaag cgatttgaagtaaagaagtggaatgcggtggcactgtgggcctgggacattgtggtggat aactgtgctatctgtcggaaccacatcatggatctctgtatagagtgccaggccaaccaa gcttctgcaacctctgaggagtgcactgtagcctggggtgtctgcaatcatgctttccat ttccactgtatttctcgctggctgaaaaccagacaggtttgccctctggacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system