Latimeria chalumnae (coelacanth): 102352187 Help Entry 102352187         CDS       T02913                                  Symbol RBX1 Name (RefSeq) ring-box 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm03420   Nucleotide excision repair lcm04110   Cell cycle lcm04114   Oocyte meiosis lcm04120   Ubiquitin mediated proteolysis lcm04141   Protein processing in endoplasmic reticulum lcm04310   Wnt signaling pathway lcm04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:lcm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102352187 (RBX1)    04120 Ubiquitin mediated proteolysis     102352187 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     102352187 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102352187 (RBX1)    04350 TGF-beta signaling pathway     102352187 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102352187 (RBX1)    04114 Oocyte meiosis     102352187 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lcm04121]     102352187 (RBX1)    03400 DNA repair and recombination proteins [BR:lcm03400]     102352187 (RBX1) Enzymes [BR:lcm01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102352187 (RBX1) Ubiquitin system [BR:lcm04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102352187 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      102352187 (RBX1)    Cul2 complex      102352187 (RBX1)    Cul3 complex      102352187 (RBX1)    Cul4 complex      102352187 (RBX1)    Cul7 complex      102352187 (RBX1)    Cul8 complex      102352187 (RBX1)    Cul9 complex      102352187 (RBX1) DNA repair and recombination proteins [BR:lcm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102352187 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       102352187 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  102352187 NCBI-ProteinID:  XP_006011017 Ensembl:  ENSLACG00000005069 UniProt:  H3A7T4 LinkDB All DBs Position Un AA seq 108 aa AA seqDB search MAAAMDVDTPSGANSGGSKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggctgcaatggatgtggacaccccgagcggagccaatagcggcggcagtaagaag cgcttcgaggtcaaaaagtggaatgcggtggctctctgggcctgggacatcgtcgtcgat aactgtgccatctgtagaaatcacatcatggacctctgtatagaatgccaagcaaaccag gcctctgctacttctgaagaatgcactgtcgcatggggggtctgcaatcacgcgttccac tttcattgcatctcgcgctggctaaagacccggcaggtctgccctctggacaacagagaa tgggaattccaaaagtacggccattag

DBGET integrated database retrieval system